KEGG   Pseudomonas soli: O165_014790
Entry
O165_014790       CDS       T03276                                 

Definition
(GenBank) 50S rRNA methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
pmos  Pseudomonas soli
Brite
KEGG Orthology (KO) [BR:pmos00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pmos03009]
    O165_014790
Enzymes [BR:pmos01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     O165_014790
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     O165_014790
Ribosome biogenesis [BR:pmos03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    O165_014790
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_24 Methyltransf_11 Methyltransf_15 PrmA
Other DBs
NCBI-ProteinID: AIN59482
LinkDB
Position
complement(3111078..3113276)
AA seq 732 aa
MSDRFELYLTCPKGLEGLLAEEARQLGLSEVREHTSAIRGDADMETAYRLCLWSRLANRV
LLVLKRFSMKNADDLYDGVHALDWADHLAADGTLAVEFSGHGSGIDNTHFGALKVKDAIV
DKLRNREGLRPSVEKVDPDVRVHLRLDRGEAILSLDLSGHSLHQRGYRLQQGAAPLKENL
AAAVLIRSGWPRIAAEGGALADPMCGVGTFLVEAAMIAADIAPNLKRERWGFTAWLGHVP
ALWRKLHDEAQARAQVGLAKPPLWIRGYEADPRLIQPGRNNVERAGLGDWVKIYQGEVAS
FEPRPDQNQKGLVISNPPYGERLGDEASLLYLYQNLGERLRQACMGWDAAVFTGAPELGK
RMGIRSHKQYAFWNGALPCKLLLFKVQPDQFVTGDRRQAQPEAGEGEPRRQAAVASEPAR
LSEGAQMFANRLQKNFKQLGKWARREKVDCYRVYDADMPEYALAVDLYHDWVHVQEYAAP
RSIDPDKAQARLLDALSAIPQALGVDPQRVVLKRRERQTGTRQYERQATEGRFQEVSEGG
VKLLVNLTDYLDTGLFLDHRPMRLRIQREAAGKRFLNLFCYTATASVHAAKGGARSTTSV
DLSKTYLDWARRNLSLNGFSERNRLEQGDVMAWLENAQDSYDLIFIDPPTFSNSKRMEGV
FDVQRDHVQLLDLAMARLAPGGVLYFSNNFRKFQLDEHLATRYAVEEISAQTLDPDFARN
NRIHRAWQLRLR
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgtcggaccgtttcgaactttatctcacctgccccaagggtcttgaaggcctgctcgcc
gaggaggcccgccaattgggcctgagcgaggtgcgtgaacacacctcggccattcgcggc
gacgccgatatggaaaccgcctatcgcctgtgcctgtggtcgcgcctggccaaccgggtg
ctgctggtgctcaagcgtttttcaatgaagaacgccgatgacctctatgacggtgtgcat
gccctcgattgggctgatcacctggcggccgacggtacgctggcggtggagttcagcggc
catggttcgggtatcgacaacacccacttcggcgccctgaaagtgaaggacgccatcgtc
gacaagctgcgcaaccgcgaaggcctgcgcccgtcggtggagaaggtcgacccggatgtg
cgcgtacacctgcgcctggaccgtggcgaggccatcctgtccctcgacctgtccggccac
agcctgcaccagcgcggttatcgcctgcagcagggcgcggcgccattgaaggaaaacctg
gcagcggcggtgctgatccgttcgggctggccacgtattgcagccgagggcggcgccctg
gctgacccgatgtgcggtgtgggcaccttcctggtcgaggcggcgatgatcgccgccgac
atcgcccccaacctcaagcgcgagcgctggggcttcacggcctggctcgggcatgtgccg
gcgctgtggcgcaagctgcacgacgaggcccaggcccgtgcccaggtgggcctggccaag
ccaccgctgtggattcgtggctacgaggccgacccgcggctgatccagccggggcgcaac
aacgtcgagcgcgcaggcctgggcgactgggtgaagatctaccagggcgaggtagcgagc
ttcgaaccgcgcccggaccagaaccagaagggcttggtgatcagcaacccgccctatggc
gagcgcctgggtgatgaagccagcctgctgtacctctaccagaacctcggcgagcgcctg
cgccaggcgtgcatgggctgggacgcggcggtgttcaccggtgcgccggagctgggcaag
cgcatgggcatccgcagccacaagcaatacgctttctggaacggcgcattgccgtgcaag
ttgctgctgttcaaggtccagccggaccagttcgtcaccggcgatcgtcgccaggcccag
cccgaggcgggcgagggcgagccgcgccgccaggcagcggtggccagcgagccggcgcgc
ctgtcggaaggcgcgcagatgttcgccaatcgcctgcagaagaacttcaagcagctgggc
aagtgggcccgtcgcgagaaagtcgattgctaccgcgtgtacgatgccgacatgcccgag
tacgcgctggcagtcgacctgtatcacgactgggtacacgtgcaggaatacgccgcgccc
cgctcgatcgatccggacaaggcccaggcgcgcctgctcgacgcgctcagcgcgattccc
caagccctgggcgtcgatccgcagcgcgtggtgctcaagcgccgggaacgccagaccggc
actcgccagtacgaacgccaggccaccgaaggacgcttccaggaagtcagcgaaggcggc
gtcaagctgctggtcaacctcaccgactacctcgacaccggcctgttcctcgaccatcgc
ccaatgcgcctgcgtatccagcgcgaggcggcgggcaagcgcttcctcaacctgttctgc
tacaccgccacggccagcgtgcacgcagccaagggtggcgcgcgcagcaccaccagcgtc
gacctgtcgaagacttacctggactgggcacggcgcaacctgtcgctcaacggtttctcc
gagcgcaaccgcctggagcagggcgacgtcatggcctggttggagaacgcccaggacagc
tacgacctgatcttcatcgacccgccgaccttctccaactccaagcgcatggaaggggtg
ttcgacgtgcagcgcgaccatgtgcagctgctcgacctggccatggcgcgcctggcgccg
ggtggtgtgctgtacttctccaacaacttccgcaagttccagctcgacgagcacctggcg
acgcggtatgcggtggaggaaatcagcgcccagaccctggatcctgacttcgctcgcaac
aaccgcatccatcgcgcctggcagctgcgtttgcgctga

DBGET integrated database retrieval system