KEGG   Pseudomonas orientalis: BOP93_19615
Entry
BOP93_19615       CDS       T05323                                 

Definition
(GenBank) histidine kinase
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
poi  Pseudomonas orientalis
Pathway
poi01503  Cationic antimicrobial peptide (CAMP) resistance
poi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:poi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BOP93_19615
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BOP93_19615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:poi01001]
    BOP93_19615
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:poi02022]
    BOP93_19615
   01504 Antimicrobial resistance genes [BR:poi01504]
    BOP93_19615
Enzymes [BR:poi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BOP93_19615
Protein kinases [BR:poi01001]
 Histidine kinases
  OmpR family
   BOP93_19615
Two-component system [BR:poi02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   BOP93_19615
Antimicrobial resistance genes [BR:poi01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    BOP93_19615
SSDB
Motif
Pfam: HATPase_c HATPase_c_2 HisKA PhoQ_Sensor HATPase_c_5 HATPase_c_3 HAMP
Other DBs
NCBI-ProteinID: AUZ47711
UniProt: A0A0R2ZL88
LinkDB
Position
complement(4509935..4511281)
AA seq 448 aa
MIRSLRVRLMLAAATLAVLFMLGLLPAMQGAFSLALQDSIEQRLASDVTTLISAARVENN
RLLMPAQLPDERFNLTDSRLLGYIYDREGHLVWRSRATQEENINYKPRYDGRGNEFARIR
EANGQEFFVYDVEVRLLGGKSAAFSIVALQPVREYQLTLEGLRENLYLGFGAALLVLLTL
LWLGLTWGLQALRRLSQELDQIEGGTRESLSEEHPRELLRLTGSLNRLLHSEREQRARYR
DSLDDLAHSLKTPLAVLQGVSEDMAQRPEERSQAWVLQSQIERMSQQIGYQLQRASLRKS
GLVRHQVRLEPVLQSLCDTLDKVYRDKRVTVSLDLPDACDVPIEKGALLEMLGNLLENAY
RLCVKQVRISLVEHLDGSELCIEDDGPGVPPDQRARILQRGERLDRQHPGQGIGLAVVKD
IIESYHARLTLGDSALGGAAFRIHFPAL
NT seq 1347 nt   +upstreamnt  +downstreamnt
ttgattcgctcgctccgtgtgcgcctgatgctggccgccgccaccctggcggtgctgttc
atgctgggcttgttgcccgccatgcaaggtgctttcagcctggcgctgcaggattccatc
gagcagcgccttgcgtcggatgtcaccacactgatctctgcggcacgcgtggaaaataac
cggctgctcatgccggcgcagttgcccgatgagcgtttcaatctgaccgacagtcgcctg
ctcggctacatctatgaccgggaaggccacctggtatggcgctcgcgggcgacccaggaa
gaaaacatcaattacaagccgcgctacgatgggcgcggcaacgaatttgcgcgcattcgc
gaagccaacggccaggagttcttcgtctacgacgtcgaggtccgtctgttgggcggcaag
agcgcggctttcagcatcgtcgccttgcaaccggtgcgtgaataccaactgaccctcgaa
ggcctgcgcgagaatctctacctggggttcggcgcggcgttgctggtgctgttgacgctg
ctctggctcggcctgacctgggggctgcaggccctgcggcgcctgagccaggagctggac
cagatcgaaggcggcacccgcgaaagcctcagcgaagagcatccccgggaactgttgcgc
ctcaccggttccctcaaccgtttgctgcacagcgagcgtgagcagcgggcgcgctaccgc
gactccctggatgacttggcccatagcctgaaaaccccgctggcggtattgcagggtgtg
agcgaagacatggcccagcgccccgaagaacgcagccaggcgtgggtgctgcaatctcag
atcgagcgcatgagccagcagatcggctaccaattgcagcgcgccagcctgcgcaagagc
ggcctggtccgccaccaggtccgcctggagccggtgctgcaaagcctgtgtgacacgttg
gacaaggtctaccgggacaagcgcgtcaccgtgtccctcgacctgccggacgcgtgcgac
gtgcccatcgagaaaggcgccctgctcgagatgctcggcaacctgctggaaaacgcctac
cgcctatgcgtcaagcaggtccgtatcagccttgtggaacacctggacggcagtgaactg
tgcatcgaagacgacggccccggtgtgccaccggaccagcgcgcacggattctgcagcgt
ggtgagcggcttgatcgtcagcatccggggcagggcatcgggttggcggtggtcaaggac
atcatcgagagctatcacgcgcggttgaccctgggtgattcggcgctggggggcgcggcg
ttcaggattcactttccggccttgtga

DBGET integrated database retrieval system