KEGG   Pongo abelii (Sumatran orangutan): 100172513
Entry
100172513         CDS       T01416                                 

Gene name
SPHK2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00600  Sphingolipid metabolism
pon01100  Metabolic pathways
pon04020  Calcium signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04370  VEGF signaling pathway
pon04371  Apelin signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon05152  Tuberculosis
Module
pon_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100172513 (SPHK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100172513 (SPHK2)
   04371 Apelin signaling pathway
    100172513 (SPHK2)
   04020 Calcium signaling pathway
    100172513 (SPHK2)
   04072 Phospholipase D signaling pathway
    100172513 (SPHK2)
   04071 Sphingolipid signaling pathway
    100172513 (SPHK2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100172513 (SPHK2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100172513 (SPHK2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100172513 (SPHK2)
SSDB
Motif
Pfam: DAGK_cat
Other DBs
NCBI-GeneID: 100172513
NCBI-ProteinID: NP_001125597
Ensembl: ENSPPYG00000010207
UniProt: Q5RB28
LinkDB
Position
19
AA seq 244 aa
MNGHLEAEEQQDQRLDQELTGSWGHRPRSTLVRAKAMAPPPPPLAASTPLLHSEFGSYPA
RGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTY
PRGRRGARRRATRTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRP
PRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSAERA
PRSP
NT seq 735 nt   +upstreamnt  +downstreamnt
atgaatggacaccttgaagcagaggagcagcaggaccagaggttggaccaggagctgacc
gggagctggggccacaggcctaggagcaccctggtcagggctaaggccatggccccgccc
ccaccgccactggctgccagcaccccgctcctccatagcgagtttggctcctacccagcc
cgaggcccacgctttgccctcaccctcacatcgcaggccctgcacatacagcggctgcgc
cccaaacccgaagccaggccccggggtggcctggtcccgttggccgaggtctcaggctgc
tgcaccctgcgaagccgcagcccctcagactcagcggcctacttctgcatctacacctac
cctcggggccggcgcggggcccggcgcagagccactcgcaccttccgggcagatggggcc
gccacctacgaagaaaaccgtgccgaggcccagcgctgggccaccgccctcacctgtctg
ctccgaggactgccactgcccggggatggggagatcacccctgacctgctacctcggcct
ccccggttgctcctattggtcaatccctttggggggcggggcctggcctggcagtggtgt
aagaaccacgtgcttcccatgatctctgaagctgggctgtccttcaacctcatccagaca
gaacgacagaaccacgcccgggagctggtccaggggctgagcctgagtgctgaacgggct
cctagatcgccctga

KEGG   Pongo abelii (Sumatran orangutan): 100433232
Entry
100433232         CDS       T01416                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00600  Sphingolipid metabolism
pon01100  Metabolic pathways
pon04020  Calcium signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04370  VEGF signaling pathway
pon04371  Apelin signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon05152  Tuberculosis
Module
pon_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100433232 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100433232 (SPHK1)
   04371 Apelin signaling pathway
    100433232 (SPHK1)
   04020 Calcium signaling pathway
    100433232 (SPHK1)
   04072 Phospholipase D signaling pathway
    100433232 (SPHK1)
   04071 Sphingolipid signaling pathway
    100433232 (SPHK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100433232 (SPHK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100433232 (SPHK1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100433232 (SPHK1)
SSDB
Motif
Pfam: DAGK_cat
Other DBs
NCBI-GeneID: 100433232
NCBI-ProteinID: XP_002827913
Ensembl: ENSPPYG00000008657
UniProt: H2NUT4
LinkDB
Position
17
AA seq 470 aa
MSAQVLGFLRSWTPLPLAAPRDPAAAGNDAGAPTAKAPGGEGEPHSRPCDARLGSTDKEL
KAGAAATGSAPTAQGTPWQREPRVEVMDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLF
RSHVQPLLAEAEISFTLMLTERRNHARELVRSEELGRWDALVVMSGDGLMHEVVNGLMER
PDWETAIRKPLCSLPAGSGNALAASLNHYAGYEQVTSEDLLTNCTLLLCRRLLSPMNLLS
LHTASGLHLFSVLSLAWGFIADVDLESEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLP
VGGVGSKTPASPVVVEQGPVDAHLVPLEEPVPSHWTVVPDQDFVLVLALLHSHLGSEMFA
APMGRCAAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDG
RGVFAVDGELMVSEAVQGQVHPNYFWMVSGCVEPPPSWKPQQTPPPEEPL
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgtccgctcaagttctgggatttttacgcagctggactcccctccccctggcagccccg
agggatccagccgccgcagggaatgacgccggtgctcctacagccaaggctccgggcggg
gagggcgagccccacagccggccctgcgacgcccgcctgggcagcaccgataaggagctg
aaggcaggagccgccgccacgggcagcgcccccacagcgcaggggaccccctggcagcgg
gagccgcgggtcgaggttatggatccagcgggcggcccccggggcgtgctcccgcggccc
tgccgcgtgctggtgctgctgaacccgcgcggcggcaagggcaaggccctgcagctcttc
cggagtcacgtgcagccccttttggctgaggctgaaatctccttcacgctgatgctcact
gagcggcggaaccatgcgcgggagctggtgcggtcggaggagctgggccgctgggacgct
ctggtggtcatgtctggagacgggctgatgcacgaggtggtgaacgggctcatggagcgg
cctgactgggagaccgccatccggaagcccctgtgtagcctaccagcaggctctggcaac
gcgctggcagcttccttgaaccattatgctggctatgagcaggtcaccagtgaagacctc
ctgaccaactgcacgctgttgctgtgccgccggctactgtcgcccatgaacctgctgtct
ctgcacacggcttcggggctgcacctcttctctgtgctcagcctggcctggggcttcatt
gctgatgtggacctagagagtgagaagtatcggcgtctgggggagatgcgcttcactctg
ggcaccttcctgcgtctggccgccctgcgcacctaccgcggccgactggcctacctccct
gtaggaggagtcggctccaagacacctgcctcccccgttgtggtcgagcagggccccgta
gatgcacaccttgtgccactggaggagccagtgccctctcactggacagtggtgcccgac
caggacttcgtgctagtcctggcgctgctgcactcgcacctgggcagtgagatgtttgct
gcacccatgggccgctgtgcagctggtgtcatgcatctgttctacgtgcgggcgggagtg
tctcgggccatgctgctgcgcctcttcctggccatggagaagggcaggcatatggagtat
gaatgcccctacttggtatacgtgcccgtggtcgccttccgcttagagcccaaggatggg
agaggtgtgtttgcagtggatggggaattgatggttagcgaggccgtgcagggccaggtg
cacccaaactacttctggatggtcagtggttgcgtggagcccccgcccagctggaagccc
cagcagacgccacctccagaagagcccttatga

DBGET integrated database retrieval system