KEGG   Pongo abelii (Sumatran orangutan): 100173339
Entry
100173339         CDS       T01416                                 

Gene name
HMOX1
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00860  Porphyrin and chlorophyll metabolism
pon01100  Metabolic pathways
pon04066  HIF-1 signaling pathway
pon04216  Ferroptosis
pon04978  Mineral absorption
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05225  Hepatocellular carcinoma
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100173339 (HMOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100173339 (HMOX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100173339 (HMOX1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    100173339 (HMOX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100173339 (HMOX1)
   05206 MicroRNAs in cancer
    100173339 (HMOX1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100173339 (HMOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100173339 (HMOX1)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     100173339 (HMOX1)
SSDB
Motif
Pfam: Heme_oxygenase REC1
Other DBs
NCBI-GeneID: 100173339
NCBI-ProteinID: NP_001126358
Ensembl: ENSPPYG00000011762
UniProt: Q5R7E3
LinkDB
Position
22
AA seq 288 aa
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTREGFKLVMASLYHIYVA
LEEEIEHNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALGLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA
SNKAQDSAPVETPRGKTPLNTHSQAPLLRWVLTLSFLVATVAVGLYAM
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagcgtccgcaacccgacagcatgccccaggatttgtcagaggccctgaaggaggcc
accaaggaggtgcacacccaggcagagaatgctgagttcatgaggaactttcagaagggc
caggtgacccgagagggcttcaagctggtgatggcttccctgtaccacatctatgtggcc
ctggaggaggagattgagcacaacaaggagagcccagtcttcgcccctgtctacttccca
gaagagctgcaccgcaaggctgccctggagcaggacctggccttctggtacgggccccgc
tggcaggaggtcatcccctacacaccagccatgcagcgctatgtgaagcggctccacgag
gtggggcgcacagagcccgagctgctggtggcccacgcctacacccgctacctgggtgac
ctgtctgggggccaggtgctcaagaagattgctcagaaagccctgggcctgcccagctct
ggcgagggcctggccttcttcaccttccccaacattgccagtgccaccaagttcaagcag
ctctaccgctcccgcatgaactcactggagatgactccagcagtcaggcagagggtgata
gaagaggccaagaccgcgttcctgctcaacatccagctctttgaggagttgcaggagctg
ttgacccatgacaccaaggaccagagcccctcacgggcaccagggcttcgccagcgtgcc
agcaacaaagcgcaagactctgcccccgtggagactcccagagggaagaccccgctcaac
acccactcccaggctccgcttctccgatgggtccttacactcagctttctggtggcgaca
gttgctgtagggctttatgccatgtga

DBGET integrated database retrieval system