KEGG   Pongo abelii (Sumatran orangutan): 100431618
Entry
100431618         CDS       T01416                                 

Gene name
TIAM1
Definition
(RefSeq) T-lymphoma invasion and metastasis-inducing protein 1 isoform X1
  KO
K05731  T-lymphoma invasion and metastasis-inducing protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04530  Tight junction
pon04810  Regulation of actin cytoskeleton
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100431618 (TIAM1)
   04015 Rap1 signaling pathway
    100431618 (TIAM1)
   04024 cAMP signaling pathway
    100431618 (TIAM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100431618 (TIAM1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100431618 (TIAM1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100431618 (TIAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100431618 (TIAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100431618 (TIAM1)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100431618 (TIAM1)
SSDB
Motif
Pfam: RhoGEF Tiam_CC_Ex PH RBD PH_9 PDZ PDZ_2 PDZ_6 PH_11
Other DBs
NCBI-GeneID: 100431618
NCBI-ProteinID: XP_002830672
Ensembl: ENSPPYG00000011351
UniProt: H2P2Y3
LinkDB
Position
21
AA seq 1591 aa
MGNAESQHVEHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKVIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQDGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTA
ASVQSMPDSEESRLYGDDATYLAEGGRRQHSYTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETRVSPRQRSTCQRANSLGDLYVQKN
SGVTANGGPGSKFAGYCRNLVSDIPNLANHKMPPAAAEETPPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPT
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTATQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACATAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGT
EAVKKSLEGIFDDIVPDGKREKEVVLPNVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VQPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQHYVPQPEEDIYELLYKEIEICP
KVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINN
RAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTS
NPGHSLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDQSPS
PQDSTGPQLATMRQLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLL
RELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEDWDPFRFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAVSASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESVKGASVDRDLQERLQATSISQRERGRKTLDSHASRMAQLKKQAALS
GINGGLESASEEVVWVRREDFAPSRKLNTEI
NT seq 4776 nt   +upstreamnt  +downstreamnt
atgggaaacgcagaaagtcaacatgtagagcacgagttttatggagaaaagcatgccagc
ctggggcgcaagcacacgtcccgctccctgcgcctctcgcacaagacgcggaggaccagg
cacgcttcctcggggaaggtgatccacaggaactccgaagtgagcacccgatccagcagc
acccccagcatcccccagtctctggctgaaaatggcctggagcccttctcccaagatggt
accctagaagacttcgggagccccatctgggtggaccgagtggacatgggcttgagacct
gtgtcttacactgactcttctgtcactcccagcgtagacagcagcatcgtcctcacagca
gcctctgtgcagagcatgccagactctgaggagagcaggctttatggggatgacgctaca
tatttggctgagggaggcaggaggcagcattcctatacatccaatgggcccactttcatg
gagacggcgagctttaagaagaaacgctccaaatctgcagacatctggcgggaggacagc
ctggaattctcactctctgatctgagccaagaacatttaacaagcaacgaagaaatcttg
ggttccgccgaagagaaggactgcgaggaggctcgggggatggagacgcgggtgagtccg
cggcagcgcagcacctgtcagagagccaattcattgggtgacttgtatgttcagaaaaac
tctggagtgacagcaaacggggggccggggagcaaatttgcaggctactgtcggaatttg
gtgtctgatattcccaatcttgcaaaccataagatgccaccagctgctgccgaagagact
cctccgtacagtaattataacacacttccctgtaggaaatctcactgtctctctgaaggt
gccaccaacccacaaattagccatagcaacagcatgcaaggcagaagagctaaaacaact
caggatgttaatgcaggcgagggcagtgagtttgcagacagtgggattgaaggggccact
accgacacggacctcctgtccaggcgatctaatgccaccaactccagctactcacctacc
acaggccgggcctttgtgggcagcgacagcggcagcagctccaccggggatgcggctcgt
cagggggtgtacgagaacttccggcgggagctggagatgagcaccaccaacagcgagagc
ctggaggaggccggctcggcgcacagcgatgagcagagcagcggcaccctgagctccccg
ggccagtcggacatcctactgaccgccacgcagggcacggtgcgcaaggccggcgccctg
gccgtcaagaacttcctggtgcacaagaagaacaagaaggtggagtcagccacccggagg
aagtggaagcactactgggtgtccctgaaaggatgcacgctatttttctacgagagcgac
ggcagatctgggatagaccacaacagcatccccaaacacgccgtctgggtggagaacagc
attgtgcaggcagtgcctgagcaccccaagaaggactttgtcttctgcctcagcaattcc
ctgggtgatgccttcctttttcagaccactagccagacggagcttgaaaactggatcacc
gccatccactctgcctgcgccactgcagtcgcgaggcaccaccacaaggaagacacgctc
cgactcctgaaatcagagatcaaaaaactggaacagaagattgacatggatgaaaagatg
aagaaaatgggtgaaatgcagctgtcttcagtcactgactcaaagaaaaagaaaacaata
ttagatcagatctttgtctgggagcaaaatctcgagcagttccaaatggacctgtttcgt
ttccgctgttatttagccagccttcagggtggggagctgccaaaccccaaaaggcttctt
gcttttgcaagtcgaccaacgaaagtggccatgggccgccttggaatcttttccgtatcg
tcgtttcatgccctggtggcagcacgcactggtgaaactggagtgagaagacgtactcag
gccatgtccagatccgcgagcaagcgaaggagcaggttttcttctctgtggggtctggat
actacctccaaaaagaagcagggacgcccaagcatcaatcaggtgtttggagagggaacc
gaagctgtaaagaaatctttagagggaatatttgatgacattgttccagatggcaagagg
gagaaagaagtggtcttacctaacgttcaccagcacaaccctgactgcgacatttgggtc
cacgagtatttcactccatcctggttctgtctgcccaataatcagccagccctgacggtc
gtccagccaggggacactgcacgggacaccctggagctgatttgcaagacacatcaactg
gatcattctgctcattacctgcgcctgaaatttctaatagaaaacaaaatgcagcactat
gttccacagcccgaggaagacatctatgagctgctgtacaaagaaattgaaatctgtcca
aaagtcactcagagcatccacattgagaagtcagatacagctgctgatacttacgggttt
tcactttcttctgtggaagaagatggtattcgaaggctgtacgtgaatagtgtgaaggaa
accggtttagcttccaagaaaggcctgaaagcgggagatgagattcttgagatcaataat
cgtgctgctgacgccctgaactcttctatgctcaaagatttcctttcacagccctcgctg
ggcctcctggtgaggacctaccccgagctggaggaaggagtggagctgctggaaagccca
ccccaccgagtggacggccctgcggaccttggcgagagccccctcgcctttctcaccagc
aacccagggcacagcctctgcagcgagcagggcagcagtgctgagaccgctccagaggag
actgaggggccagacttggaatcctcagatgagactgatcacagcagcaagagtacagaa
caggtggccgcgttttgccgcagtttgcatgagatgaacccctctgaccagagcccatct
cctcaggactccacggggcctcaactggcgaccatgagacaactctcggatgcagataag
ctgcgcaaggtgatctgcgagctcctggagacggagcgcacctacgtgaaggatttaaac
tgtctcatggagagatacctaaagcctcttcaaaaagaaacttttctcacccaggatgag
cttgacgtgctttttggaaatttaacggaaatggtagagtttcaagtagaattccttaaa
actctagaagatggagtgagactggtacctgatttggaaaagcttgagaaggttgaccaa
tttaagaaagtgctgttctctctggggggatcgttcctgtattatgctgaccgcttcaag
ctctacagtgccttctgcgccagccacacaaaagttcccaaggtcctggtgaaagccaag
acagacacggctttcaaggcattcttggatgcccagaacccgaagcagcagcactcatcc
acgctggagtcgtacctcatcaagcccatccagaggatcctcaagtacccacttctgctc
agggagctgttcgccctgaccgatgcggagagcgaggagcactaccacctggacgtggcc
atcaagaccatgaacaaggttgccagtcacatcaatgagatgcagaaaatccacgaagag
tttggggctgtgtttgaccagctgatcgctgaacagactggtgagaaaaaagaggttgca
gatctgagcatgggagacctgcttttgcacaccaccgtgatctggctgaacccgccggcc
tcgctgggcaagtggaaaaaggaaccagagttggcagcattcgtcttcaaaactgctgtg
gtccttgtgtataaagatggttccaaacagaagaagaaacttgtaggatcgcacaggctt
tccatttatgaggactgggaccccttcagatttcgacacatgatccccacggaagcgctg
caggttcgagctttggcgagtgcagatgcagaggcaaatgccgtgtgtgaaattgtccat
gtaaaatccgagtctgaagggaggccggagagggtcttccacttgtgctgcagctccccg
gagagccgaaaggatttcctgaaggctgtgcattcaatcctgcgcgataagcacagaaga
cagctcctcaaaaccgagagccttccctcatcccagcaatatgtcccttttggaggcaaa
agattgtgtgcactgaagggggccaggccggccatgagcagggcagtgtctgccccaagc
aagtctcttgggaggaggaggcggcggctggctcgaaacaggtttaccattgattctgat
gctgtctctgcaagcagcccggagaaagagtcccagcagccccccggtggtggggacact
gaccgatgggtagaggagcagtttgatcttgctcagtatgaggagcaagatgacatcaag
gagacagacatcctcagtgacgatgatgagttctgtgagtccgtgaagggcgcctcagtg
gacagagacctgcaggagcggcttcaggccacctccatcagtcagcgggaaagaggccgg
aaaaccctggatagtcacgcgtcccgcatggcgcagctcaagaagcaagctgccctgtcg
gggatcaatggaggcctggagagcgcaagcgaggaagtcgtttgggttaggcgcgaagac
tttgccccctccaggaaactgaacactgagatctga

DBGET integrated database retrieval system