KEGG   Pongo abelii (Sumatran orangutan): 100435851
Entry
100435851         CDS       T01416                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04110  Cell cycle
pon04137  Mitophagy - animal
pon04218  Cellular senescence
pon04934  Cushing syndrome
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05212  Pancreatic cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100435851 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    100435851 (E2F1)
   04218 Cellular senescence
    100435851 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100435851 (E2F1)
   05206 MicroRNAs in cancer
    100435851 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100435851 (E2F1)
   05225 Hepatocellular carcinoma
    100435851 (E2F1)
   05226 Gastric cancer
    100435851 (E2F1)
   05214 Glioma
    100435851 (E2F1)
   05220 Chronic myeloid leukemia
    100435851 (E2F1)
   05218 Melanoma
    100435851 (E2F1)
   05219 Bladder cancer
    100435851 (E2F1)
   05215 Prostate cancer
    100435851 (E2F1)
   05224 Breast cancer
    100435851 (E2F1)
   05222 Small cell lung cancer
    100435851 (E2F1)
   05223 Non-small cell lung cancer
    100435851 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100435851 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100435851 (E2F1)
   05161 Hepatitis B
    100435851 (E2F1)
   05160 Hepatitis C
    100435851 (E2F1)
   05163 Human cytomegalovirus infection
    100435851 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100435851 (E2F1)
   05169 Epstein-Barr virus infection
    100435851 (E2F1)
   05165 Human papillomavirus infection
    100435851 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100435851 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100435851 (E2F1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100435851 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 100435851
NCBI-ProteinID: XP_024094481
Ensembl: ENSPPYG00000010929
LinkDB
Position
20
AA seq 437 aa
MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPE
ETVGGISPGKTPSQEATSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS
RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggccttggccggggcccctgcgggcggcccatgcgcgccggcgctggaggccctgctc
ggggccggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctccgccgcgcag
gacgccagcgccccgccggctcccaccggccccgcggcgcccgccgccggcccctgcgac
cctgacctgctgctcttcgccacaccgcaggcgccccggcccacacccagtgcgccgcgc
cccgcgctcggccgcccgccggtgaagcggaggctggacctggaaactgaccatcagtac
ctggccgagagcagtgggccggctcggggcagaggccgccatccaggaaaaggtgtgaaa
tccccgggggagaagtcacgctatgagacctcactgaatctgaccaccaaacgcttcctg
gagctgctgagccgctcggctgacggtgtcgtcgacctgaactgggctgccgaggtgctg
aaagtgcagaagcggcgcatctatgacatcaccaacgtcctcgagggcatccagctcatt
gccaagaagtccaagaaccacatccagtggctgggcagccacaccacagtgggcgttggc
gggcggcttgaggggttgacccaggacctccggcagctgcaggagagcgagcagcagctg
gaccacctgatgaatatctgtactacgcagctgcgcctgctctccgaggacactgacagc
cagcgcctggcctacgtgacgtgtcaggaccttcgtagcattgcagaccctgcagagcag
atggttatggtgatcaaagcccctcctgagacccagctccaagccgtggactcttcggag
acctttcagatctcccttaagagcaaacaaggccccatcgatgttttcctgtgccctgag
gagaccgtaggtgggatcagccctgggaagaccccgtcccaggaggccacttctgaggag
gagaacagggccactgactctgccaccatagtgtcaccaccaccgtcatctcccccctca
tccctcaccacagatcccagccagtctctactcagcctggagcaagaaccgctgttgtcc
cggatgggcagcctgcgggctcccgtggacgaggaccgcctgtccccgctggtggcggcc
gactcgctcctggagcatgtgcgggaggacttctccggcctcctccctgaggagttcatc
agcctttccccaccccacgaggccctcgactaccacttcggcctcgaggagggcgagggc
atcagagacctcttcgactgtgactttggggacctcacccccctggatttctga

KEGG   Pongo abelii (Sumatran orangutan): 100448297
Entry
100448297         CDS       T01416                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X3
  KO
K06620  transcription factor E2F3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04110  Cell cycle
pon04218  Cellular senescence
pon04934  Cushing syndrome
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05212  Pancreatic cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100448297 (E2F3)
   04218 Cellular senescence
    100448297 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100448297 (E2F3)
   05206 MicroRNAs in cancer
    100448297 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100448297 (E2F3)
   05225 Hepatocellular carcinoma
    100448297 (E2F3)
   05226 Gastric cancer
    100448297 (E2F3)
   05214 Glioma
    100448297 (E2F3)
   05220 Chronic myeloid leukemia
    100448297 (E2F3)
   05218 Melanoma
    100448297 (E2F3)
   05219 Bladder cancer
    100448297 (E2F3)
   05215 Prostate cancer
    100448297 (E2F3)
   05224 Breast cancer
    100448297 (E2F3)
   05222 Small cell lung cancer
    100448297 (E2F3)
   05223 Non-small cell lung cancer
    100448297 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100448297 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100448297 (E2F3)
   05161 Hepatitis B
    100448297 (E2F3)
   05160 Hepatitis C
    100448297 (E2F3)
   05163 Human cytomegalovirus infection
    100448297 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100448297 (E2F3)
   05169 Epstein-Barr virus infection
    100448297 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100448297 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100448297 (E2F3)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100448297 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB
Other DBs
NCBI-GeneID: 100448297
NCBI-ProteinID: XP_009239734
UniProt: A0A2J8WND3
LinkDB
Position
6
AA seq 224 aa
MGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTY
QDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSPM
KTNNQDHNGNIPKPASKDLASTNSGHSDCSISMGNLSPLASPANLLQQTEDQIPSNLEGP
FVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 675 nt   +upstreamnt  +downstreamnt
atgggctgcagtctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtcaaaa
gaagtgaccgagctcagtcaggaagagaagaaattagatgaactgatccaaagctgcacc
ctggacctcaaactgttaaccgaggattcagagaatcaaaggttagcttatgttacatat
caagatattcgaaaaattagtggccttaaagaccaaactgttatagttgtgaaagcccct
ccagaaacaagacttgaagtgcctgactcaatagagagcctacaaatacatttggcaagt
acccaagggcccattgaggtttacttatgtccagaagagactgaaacacacagtccaatg
aaaacaaacaaccaagaccacaatgggaatatccctaaacccgcttccaaagacttggct
tcaaccaactcaggacatagcgattgctcaatttctatgggaaatctttctcctctggcc
tccccagccaacctcttacagcagactgaggaccaaattccttccaacctagaaggaccg
tttgtgaacttactgcctcccctgctgcaagaggactatctcctgagcctcggggaggag
gaaggcatcagcgatctctttgacgcttacgatttggaaaagctcccactggtggaagac
ttcatgtgtagttga

KEGG   Pongo abelii (Sumatran orangutan): 100458002
Entry
100458002         CDS       T01416                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2 isoform X1
  KO
K09389  transcription factor E2F2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04110  Cell cycle
pon04218  Cellular senescence
pon04934  Cushing syndrome
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05212  Pancreatic cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100458002 (E2F2)
   04218 Cellular senescence
    100458002 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100458002 (E2F2)
   05206 MicroRNAs in cancer
    100458002 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100458002 (E2F2)
   05225 Hepatocellular carcinoma
    100458002 (E2F2)
   05226 Gastric cancer
    100458002 (E2F2)
   05214 Glioma
    100458002 (E2F2)
   05220 Chronic myeloid leukemia
    100458002 (E2F2)
   05218 Melanoma
    100458002 (E2F2)
   05219 Bladder cancer
    100458002 (E2F2)
   05215 Prostate cancer
    100458002 (E2F2)
   05224 Breast cancer
    100458002 (E2F2)
   05222 Small cell lung cancer
    100458002 (E2F2)
   05223 Non-small cell lung cancer
    100458002 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100458002 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100458002 (E2F2)
   05161 Hepatitis B
    100458002 (E2F2)
   05160 Hepatitis C
    100458002 (E2F2)
   05163 Human cytomegalovirus infection
    100458002 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100458002 (E2F2)
   05169 Epstein-Barr virus infection
    100458002 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100458002 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100458002 (E2F2)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100458002 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 100458002
NCBI-ProteinID: XP_002811353
Ensembl: ENSPPYG00000001739
UniProt: H2N8M5
LinkDB
Position
1
AA seq 437 aa
MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPG
TCLDATPHRPEGQVVRCLPAGRLPAKRKLDLEGIGRPAVPEFPTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQELDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
PPPSLVPLEATDSMLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctgcaagggccccgggccttggcttcggccgctgggcagaccccgaaggtggtgcct
gcgatgagccccacagagctgtggccatccggcctcagcagcccccagctctgcccggct
actgctacctactacacaccgctgtacccgcagacggcgcctcccgcagcggcgccaggc
acctgtctcgacgccactcctcacagacccgagggccaagttgtgcgatgcctgccggca
ggccggctgccggccaaaaggaagctggatctggaggggattgggaggcccgccgtccct
gagttcccaacccccaaggggaagtgcatcagagtggatggcctccccagccccaaaacc
cccaaatcccccggggagaagactcggtatgacacctcgctggggctgctcaccaagaag
ttcatttacctcctgagcgagtcagaggatggggtcctggacttgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctggaaggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccaccagacctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacacg
gagcaggccttggaccagctcatccagagctgttctctgagcttcaagcacctgactgag
gacaaggccaacaagaggctggcctatgtgacttaccaggatatccgtgctgtcggcaac
tttaaggagcagacagtgattgccgtcaaggcccctccgcagacgagactggaagtgcct
gacaggactgaggacaacctgcagatatatctcaagagcacccaagggcccatcgaagtc
tacctgtgcccagaggaggtacaggagctggacagtccttccgaggagcctctcccctct
acctccaccctctgccccagccctgactctgcccagcccagcagcagcaccgaccctagc
atcatggagcccacagcatcctcagtgccagcgccagcgccaaccccccagcaggcccca
ccgcctccatccctggtccccttggaggctactgacagcatgctggagctgccgcaccca
ctcctgcagcagactgaggaccagttcctgtccccaaccctggcgtgcagctcccctctg
atcagcttctccccatccttggaccaggatgactacctgtggggcttggaggcgggtgag
ggcatcagcgacctcttcgactcctacgaccttggggacctgttgattaattga

DBGET integrated database retrieval system