KEGG   Pongo abelii (Sumatran orangutan): 100436950
Entry
100436950         CDS       T01416                                 

Gene name
MAX
Definition
(RefSeq) protein max isoform X4
  KO
K04453  Max protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100436950 (MAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100436950 (MAX)
   05202 Transcriptional misregulation in cancer
    100436950 (MAX)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100436950 (MAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100436950 (MAX)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    100436950 (MAX)
SSDB
Motif
Pfam: HLH DUF5716 Filament SlyX Jnk-SapK_ap_N bZIP_2 DUF5595 ZapB DUF4763 Csm1_N ATG16 V_ATPase_I
Other DBs
NCBI-GeneID: 100436950
NCBI-ProteinID: XP_002824897
Ensembl: ENSPPYG00000005911
UniProt: A0A663DH96 H2NLJ2
LinkDB
Position
14
AA seq 160 aa
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN
SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
NT seq 483 nt   +upstreamnt  +downstreamnt
atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct
gcggcagacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa
gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg
gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca
caccagcaagatattgatgacctcaagcggcagaatgctcttctggagcagcaagtccgt
gcactggagaaggcgaggtcaagtgcccaactgcagaccaactacccctcctcagacaac
agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcggactcc
agctcggagtctgagcctgaagagccccaaagcaggaagaagctccggatggaggccagc
taa

DBGET integrated database retrieval system