Pongo abelii (Sumatran orangutan): 100436950 Help Entry 100436950         CDS       T01416                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon03083   Polycomb repressive complex pon04010   MAPK signaling pathway pon05200   Pathways in cancer pon05202   Transcriptional misregulation in cancer pon05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:pon00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     100436950 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100436950 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100436950 (MAX)    05202 Transcriptional misregulation in cancer     100436950 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     100436950 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pon03000]     100436950 (MAX)    03036 Chromosome and associated proteins [BR:pon03036]     100436950 (MAX) Transcription factors [BR:pon03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     100436950 (MAX) Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      100436950 (MAX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH JetA Filament bZIP_2 bHLH_INO4 SlyX bHLH_INO2 SLX9 GAGA_bind DUF7801 DUF4763 XhlA Csm1_N ATG16 Motif Other DBs NCBI-GeneID:  100436950 NCBI-ProteinID:  XP_002824897 Ensembl:  ENSPPYG00000005911 UniProt:  A0A663DH96 LinkDB All DBs Position 15:complement(69237626..69265441) Genome browser AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggcagacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgatgacctcaagcggcagaatgctcttctggagcagcaagtccgt gcactggagaaggcgaggtcaagtgcccaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcggactcc agctcggagtctgagcctgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system