KEGG   Pongo abelii (Sumatran orangutan): 100437870
Entry
100437870         CDS       T01416                                 

Gene name
HBEGF
Definition
(RefSeq) proheparin-binding EGF-like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04012  ErbB signaling pathway
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon05171  Coronavirus disease - COVID-19
pon05205  Proteoglycans in cancer
pon05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100437870 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100437870 (HBEGF)
   04915 Estrogen signaling pathway
    100437870 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    100437870 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100437870 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    100437870 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100437870 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100437870 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100437870 (HBEGF)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100437870 (HBEGF)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 100437870
NCBI-ProteinID: XP_002816007
Ensembl: ENSPPYG00000015852
UniProt: H2PGR8 A0A6D2X8J8
LinkDB
Position
5
AA seq 208 aa
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTGSTDQLLPLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPSKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYSYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtggtgctgaagctctttctggctgcagttctctcggcactg
gtgactggcgagagcctggagcggcttcggagagggctagctgctggaaccagcaatccg
gacccacctactggatccacggatcagctgctacccctaggaggcggccgggaccggaaa
gtccgtgacttgcaagaggcagatctggaccttttgagagtcactttatcctccaagcca
caagcactggccacaccaagcaaggaggagcacgggaaaagaaagaagaaaggcaagggg
ctagggaagaagagggacccatgtcttcggaaatacaaggacttctgcatccatggagaa
tgcaaatatgtgaaggagctccgggctccctcctgcatctgccacccgggttaccatgga
gagaggtgtcatgggctgagcctcccagtggaaaatcgcttatatagctatgaccacaca
accatcctggccgtggtggccgtggtgctgtcatctgtctgtctgctggtcatcgtgggg
cttctcatgtttaggtaccataggagaggaggttatgatgtggaaaatgaagagaaagtg
aagttgggcatgactaattcccactga

DBGET integrated database retrieval system