KEGG   Pongo abelii (Sumatran orangutan): 100440745
Entry
100440745         CDS       T01416                                 

Gene name
SP1
Definition
(RefSeq) transcription factor Sp1 isoform X1
  KO
K04684  transcription factor Sp1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04137  Mitophagy - animal
pon04350  TGF-beta signaling pathway
pon04915  Estrogen signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05224  Breast cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100440745 (SP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100440745 (SP1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100440745 (SP1)
   04928 Parathyroid hormone synthesis, secretion and action
    100440745 (SP1)
   04927 Cortisol synthesis and secretion
    100440745 (SP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440745 (SP1)
   05202 Transcriptional misregulation in cancer
    100440745 (SP1)
   05231 Choline metabolism in cancer
    100440745 (SP1)
  09162 Cancer: specific types
   05224 Breast cancer
    100440745 (SP1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100440745 (SP1)
   05017 Spinocerebellar ataxia
    100440745 (SP1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100440745 (SP1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100440745 (SP1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100440745 (SP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100440745 (SP1)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100440745 (SP1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100440745 (SP1)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100440745 (SP1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 100440745
NCBI-ProteinID: XP_002823363
Ensembl: ENSPPYG00000004579
UniProt: A0A663DCW8 H2NHH0
LinkDB
Position
12
AA seq 786 aa
MSDQDHSMDEMTAVVKIEKGVGGSNGGNGNGGGAFSQARSSSTGSSSSSGGGGGQESQPS
PLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPT
SKEQSGSSTNGSNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQF
QTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQ
GLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPV
TSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRV
SGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAP
LSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQA
QTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGT
SGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRT
RREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCT
WSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVAL
SVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSIN
ISGNGF
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaaatgacagctgtggtgaagattgaaaaagga
gttggtggcagtaatgggggcaatggtaatggtggtggtgccttttcacaggctcgaagt
agcagcacaggcagtagcagcagcagtggaggaggaggagggcaggagtcccagccatcc
cctttggctctgctggcagcaacttgcagcagaattgagtcacccaatgagaacagcaac
aactcccagggcccgagtcagtcagggggaacaggtgagcttgacctcacagccacacaa
ctttcacagggtgccaatggctggcagatcatctcttcctcctctggggctacccctacc
tcaaaggaacagagtggcagcagtaccaatggcagcaatggcagtgagtcttccaagaat
cgcacagtctctggtgggcagtatgttgtggctgccactcccaacttacagaaccagcaa
gttctgacaggactacctggagtgatgcctaatattcagtatcaagtaatcccacagttc
cagaccgttgatgggcaacagctgcagtttgctgccactggggcccaagtgcagcaggat
ggttctggtcaaatacagatcataccaggtgcaaaccaacagattatcacaaatcgagga
agtggaggcaacatcattgctgctatgccaaacctactccagcaggctgtccccctccaa
ggcctggctaataacgtactctcaggacagactcagtatgtgaccaatgtaccagtggcc
ctgaatgggaacatcaccttgctacctgtcaacagcgtttctgcagctaccttgactccc
agctctcaggcagtcacgatcagcagctctgggtcccaggagagtggctcacagcctgtc
acctcagggactaccatcagttctgccagcttggtgtcatcacaagccagttccagctcc
tttttcaccaatgccaatagctactcaactactactaccaccagcaacatgggaattatg
aactttactaccagtggatcatcagggaccaactctcaaggccagacaccccagagggtc
agtgggctacaggggtctgatgctctgaacatccagcaaaaccagacatctggaggctca
ttgcaagcaggccagcaaaaagaaggagagcaaaaccagcagacacagcagcaacaaatt
cttatccagcctcagctagttcaagggggacaggccctccaggccctccaagcagcacca
ttgtcagggcagacctttacaactcaagccatctcccaggaaaccctccagaatctccag
cttcaggctgttccaaactctggtcccatcatcatccggacaccaacagtggggcccaat
ggacaggtcagttggcagactctacagctgcagaacctccaagttcagaacccacaagcc
cagacaatcaccttagccccaatgcagggtgtttccttggggcagaccagcagcagcaac
accactctcacacccattgcctcagctgcttccattcctgctggcacagtcactgtgaat
gctgctcaactctcctccatgccaggcctccagaccattaacctcagtgcattgggtact
tcaggaatccaggtgcacccaattcaaggcctgccgttggctatagcaaatgccccaggt
gatcatggagctcagcttggtctccacggggctggtggtgatggaatacatgatgacaca
gcaggtggagaggaaggagaaaacagcccagatgcccaaccccaagccggtcggaggacc
cggcgggaagcatgcacctgcccctactgtaaagacagtgaaggaaggggctcgggggat
cctggcaaaaagaaacagcatatttgccacatccaaggctgtgggaaagtgtatggcaag
acctcacacctgcgggcacacttgcgctggcatacaggcgagaggccatttatgtgtacc
tggtcatactgtgggaaacgcttcacacgttcggatgagctacagaggcacaaacgtaca
cacacaggtgagaagaaatttgcctgccctgagtgtcctaagcgcttcatgaggagtgac
cacctgtcaaaacatatcaagacccaccagaataagaagggaggcccaggtgtagctctg
agtgtgggcactttgcccctggacagtggggcaggttcagaaggcagcggcactgccact
ccttcagcccttattaccaccaatatggtagccatggaggccatctgtccagagggcatt
gcccgtcttgccaacagtggcatcaacgtcatgcaggtggcagatctgcagtccattaat
atcagtggcaatggcttctga

DBGET integrated database retrieval system