KEGG   Pongo abelii (Sumatran orangutan): 100440983
Entry
100440983         CDS       T01416                                 

Gene name
PTPN11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11 isoform X1
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04072  Phospholipase D signaling pathway
pon04360  Axon guidance
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04670  Leukocyte transendothelial migration
pon04722  Neurotrophin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04931  Insulin resistance
pon05168  Herpes simplex virus 1 infection
pon05205  Proteoglycans in cancer
pon05211  Renal cell carcinoma
pon05220  Chronic myeloid leukemia
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100440983 (PTPN11)
   04630 JAK-STAT signaling pathway
    100440983 (PTPN11)
   04072 Phospholipase D signaling pathway
    100440983 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100440983 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    100440983 (PTPN11)
   04670 Leukocyte transendothelial migration
    100440983 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100440983 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100440983 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    100440983 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100440983 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100440983 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100440983 (PTPN11)
   05211 Renal cell carcinoma
    100440983 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100440983 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100440983 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100440983 (PTPN11)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100440983 (PTPN11)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100440983 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 100440983
NCBI-ProteinID: XP_009246546
LinkDB
Position
12
AA seq 597 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaatatcactggtgtggaggcagaaaacctactg
ttgacaagaggagttgatggcagttttttggcaaggcctagtaaaagtaaccctggagac
ttcacactttccgttagaagaaatggagctgtcacccacatcaagattcagaacactggt
gattactatgacctgtatggaggggagaaatttgccactttggctgagttggtccagtat
tacatggaacatcacgggcaattaaaagagaagaatggagatgtcattgagcttaaatat
cctctgaactgtgcagatcctacctctgaaaggtggtttcatggacacctctctgggaaa
gaagcagagaaattattaactgaaaaaggaaaacatggtagttttcttgtacgagagagc
cagagccaccctggagattttgttctttctgtgcgcactggtgatgacaaaggggagagc
aatgacggcaagtctaaagtgacccatgttatgattcgctgtcaggaactgaaatacgac
gttggtggaggagaacggtttgattctttgacagatcttgtggaacattataagaagaat
cctatggtggaaacattgggtacagttctacaactgaagcagccccttaacacgactcgt
ataaatgctgctgaaatagaaagcagagttcgagaactaagcaaattagctgagaccaca
gataaagtcaaacaaggcttttgggaagaatttgagacactacaacaacaggagtgcaaa
cttctctacagccgaaaagagggtcaaaggcaagaaaacaaaaacaaaaatagatataaa
aacatcctgccctttgatcataccagggttgtcctacacgatggtgatcccaatgagcct
gtttcagattacatcaatgcaaatatcatcatgcctgaatttgaaaccaagtgcaacaat
tcaaagcccaaaaagagttacattgccacacaaggctgcctgcaaaacacggtgaacgac
ttttggcggatggtgttccaagaaaactcccgagtgattgtcatgacaacgaaagaagtg
gagagaggaaagagtaaatgtgtcaaatactggcctgatgagtatgctctaaaagaatat
ggcgtcatgcgtgttaggaacgtcaaagaaagtgccgctcatgactatacgctaagagaa
cttaaactttcaaaggttggacaagctctactccaggggaatacggagagaacggtctgg
caataccactttcggacctggccggaccacggagtgcccagcgaccccgggggcgtgctg
gacttcctggaggaggtgcaccataagcaggagagcatcatggatgcagggccggtcgtg
gtgcactgcagtgctggaattggccggacagggacgttcattgtgattgatattcttatt
gacatcatcagagagaaaggtgttgactgcgacattgatgttcccaaaaccatccagatg
gtgcggtctcagaggtcagggatggtccagacagaagcacagtaccgatttatctatatg
gcggtccagcattatattgaaacactacagcgcaggattgaagaagagcagaaaagcaag
aggaaagggcacgaatatacaaatattaagtattctctagcggaccagacgagtggagat
cagagccccctcccgccttgtactccaacgccaccctgtgcagaaatgagagaagacagt
gctagagtctatgaaaacgtgggcctgatgcaacagcagaaaagtttcagatga

DBGET integrated database retrieval system