KEGG   Pongo abelii (Sumatran orangutan): 100442085
Entry
100442085         CDS       T01416                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04260  Cardiac muscle contraction
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04742  Taste transduction
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04921  Oxytocin signaling pathway
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04927  Cortisol synthesis and secretion
pon04929  GnRH secretion
pon04930  Type II diabetes mellitus
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05031  Amphetamine addiction
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100442085 (CACNA1C)
   04020 Calcium signaling pathway
    100442085 (CACNA1C)
   04024 cAMP signaling pathway
    100442085 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    100442085 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100442085 (CACNA1C)
   04929 GnRH secretion
    100442085 (CACNA1C)
   04912 GnRH signaling pathway
    100442085 (CACNA1C)
   04921 Oxytocin signaling pathway
    100442085 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    100442085 (CACNA1C)
   04924 Renin secretion
    100442085 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    100442085 (CACNA1C)
   04927 Cortisol synthesis and secretion
    100442085 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100442085 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    100442085 (CACNA1C)
   04270 Vascular smooth muscle contraction
    100442085 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    100442085 (CACNA1C)
   04727 GABAergic synapse
    100442085 (CACNA1C)
   04725 Cholinergic synapse
    100442085 (CACNA1C)
   04728 Dopaminergic synapse
    100442085 (CACNA1C)
   04726 Serotonergic synapse
    100442085 (CACNA1C)
   04720 Long-term potentiation
    100442085 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    100442085 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    100442085 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100442085 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100442085 (CACNA1C)
   05020 Prion disease
    100442085 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    100442085 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    100442085 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100442085 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100442085 (CACNA1C)
   05414 Dilated cardiomyopathy
    100442085 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100442085 (CACNA1C)
   04934 Cushing syndrome
    100442085 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pon04040]
    100442085 (CACNA1C)
Ion channels [BR:pon04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100442085 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 100442085
NCBI-ProteinID: XP_024112226
LinkDB
Position
12
AA seq 2191 aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNTNAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNRGTPAGMLDQKKGKFAW
FSHSTETHVSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRR
KCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKM
YSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWN
SLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQS
LLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDN
LADAESLTSAQKEEEEEKERKKLARTASPEKKQELVEKPAVEESKEEKIELKSITADGES
PPTTKINMDDLQPNENEDKSPYPNPEATGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMP
EASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFY
FDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVK
ILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKL
YTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFE
GWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQ
EYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTIC
LAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSI
IDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEENSRISITF
FRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAL
NDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPC
GSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPE
AKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVR
TALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEY
FRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAV
SAASEDDIFRRAGGLFGNHVSYYQSDSRSAFPQTFTTQRPLHINKAGSSQGDTESPSHEK
LVDSTFTPSSYSSTGSNANINNANNTALGRLPRPTGYPSTVSTVEGHGPPLSPAIRVQEV
AWKLSSNRCHSRESQTAMAGQEETSQDETYEVKMNHDTEACSEPSLLSTEMLSYQDDENR
QLTLPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHH
QALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPVPTLRLEGVESSEKLNSSF
PSIHCGSWAETTPDGGGSSAARKARPVSLMVPGQAGAPGRQFHGSASSLVEAVLISEGLG
QFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDR
AGGEEDAGCVRARGRLSEEELQDSRVYVSSL
NT seq 6576 nt   +upstreamnt  +downstreamnt
atggtcaatgagaatacgaggatgtacattccagaggaaaaccaccaaggttccaactat
gggagcccacgccccgcccatgccaacatgaacaccaatgcagcggcggggctggcccct
gagcacatccccaccccgggggccgccctgtcctggcaggcggccatcgacgcagcccgg
caggctaagctgatgggcagcgctggcaatgcgaccatctccacagtcagctccacgcag
cggaagcggcagcaatatgggaaacccaagaagcagggcagcaccacggccacacgcccg
ccccgagccctgctctgcctgaccctgaagaaccccatccggagggcctgcatcagcatt
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagcgatctatattccctttccagaagatgattccaacgccaccaattccaacctggaa
cgagtggaatatctctttctcataatttttacggtggaagcgtttttaaaagtaatcgcc
tatggactcctctttcaccctaatgcctacctccgcaatggctggaacctactagatttt
ataattgtggttgtggggctttttagtgcaattttagaacaagcaaccaaagcagacggg
gcgaacgctctcggagggaaaggggccggatttgatgtgaaggcactgagggccttccgc
gtgctgcgccccctgcggcttgtgtccggagtcccaagtctccaggtggtcctgaattcc
atcatcaaggccatggtccccctgctgcacatcgccctgcttgtgctgtttgtcatcatc
atctacgccatcatcggcctggagctcttcatggggaagatgcacaagacctgctacaac
caggagggcatagcagatgttccagcagaagatgacccttccccttgtgcgctggaaaca
ggccacgggcggcagtgccagaacggcacagtgtgcaaacccggctgggatgggcccaag
cacggcatcaccaactttgacaactttgccttcgccatgctgacggtgttccagtgcatc
accatggagggctggacggatgtgctgtactgggtcaatgatgccgtaggaagggactgg
ccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttggtt
ctcggtgtgcttagcggagagttttccaaagagagggagaaggccaaggcccggggagat
ttccagaagctgcgggagaagcagcagctagaagaggatctcaaaggctacctggattgg
atcactcaggccgaagacatcgatcctgagaacgaggacgaaggcatggatgaggagaag
ccccgaaacagaggcactccggcgggcatgcttgatcagaagaaagggaagtttgcttgg
tttagtcactccacagaaacccatgtgagcatgcccaccagtgagaccgagtccgtcaac
accgaaaacgtagctggaggtgacatcgagggagaaaactgtggggccaggctggcccac
cggatctccaagtcaaagttcagccgctactggcgccggtggaatcggttctgcagaaga
aagtgccgcgccgcagtcaagtctaatgtcttctactggctggtgattttcctggtgttc
ctcaacacgctcaccattgcctccgagcactacaaccagccccactggctcacagaagtc
caagacacagcgaacaaggccctgctggccctgttcacggcggagatgctcctgaaaatg
tacagcctgggcctgcaggcctacttcgtgtccctcttcaaccgctttgactgcttcgtc
gtgtgtggtggcatcctggagaccatcctggtggagaccaagatcatgtccccactgggc
atctccgtgctcagatgtgtccggctgctgaggatattcaagatcacaaggtactggaac
tccttgagcaacctggtggcatccttgctgaactctgtgcgctccatcgcctccctgctc
cttctcctcttccttttcatcatcatcttctccctcctggggatgcagctctttggagga
aagttcaactttgatgagatgcagacccggaggagcacatttgataacttcccccagtcc
ctcctcactgtgtttcagatcctgaccggggaggactggaattcggtgatgtatgatggg
atcatggcttatggcggcccctcttttccagggatgttagtctgtatttacttcatcatc
ctcttcatctgtggaaactatatcctactgaatgtgttcttggccattgctgtggacaac
ctggctgatgctgagagcctcacatctgcccagaaggaggaggaagaggagaaggagaga
aagaagctggccaggactgccagcccagagaagaaacaagagttggtggagaagccagca
gtggaggaatccaaggaggagaagattgagttgaaatccatcacagctgatggagagtct
ccacccaccaccaagatcaacatggatgacctccagcccaatgaaaatgaggataagagc
ccctaccccaacccagaagctacaggagaagaggatgaggaggagccagagatgcctgtc
ggccctcgcccacgaccactctctgagcttcaccttaaggaaaaggcagtgcccatgcca
gaagccagcgcgtttttcatcttcagctctaacaacaggtttcgcctccagtgccaccgc
attgtcaatgacacgatcttcaccaacctgatcctcttcttcattctgctcagcagcatt
tccctggctgctgaggacccagtccagcacacctccttcaggaaccatattctgttttat
tttgatattgtttttaccaccattttcaccattgaaattgctctgaagatgactgcttat
ggggctttcctgcacaagggctctttctgccggaactacttcaacatcctggacctgctg
gtggtcagcgtgtccctcatctcctttggcatccagtccagtgcaatcaatgtcgtgaag
atcttgcgagtcctgcgagtactcaggcccctgagggccatcaacagggccaaggggcta
aagcatgtggttcagtgtgtgtttgtcgccatccggaccatcgggaacatcgtgattgtc
accactctgctgcagttcatgtttgcctgcatcggcgtccagctcttcaagggaaagctg
tacacctgttcagacagttccaagcagacagaggcggaatgcaagggcaactacatcacg
tacaaagacggggaggttgaccaccccatcatccaaccccgcagctgggagaacagcaag
tttgactttgacaatgttctggcagccatgatggccctcttcaccgtctccaccttcgaa
gggtggccagagctgctgtaccgctccatcgactcccacacagaagacaagggccccatc
tacaactaccgtgtggagatctccatcttcttcatcatctacatcatcatcatcgccttc
ttcatgatgaacatcttcgtgggcttcgtcatcgtcacctttcaggagcagggggagcag
gagtacaagaactgtgagctggacaagaaccagcgacagtgcgtggaatacgccctcaag
gcccggcccctgcggaggtacatccccaagaaccagcaccagtacaaagtgtggtatgtg
gtcaactccacctacttcgagtacctgatgtttgtcctcatcctgctcaacaccatctgc
ctggccatgcagcactacggccagagctgcctgttcaaaatcgccatgaacatcctcaac
atgcttttcactggcctcttcaccgtggagatgatcctgaagctcattgccttcaaaccc
aagggttactttagtgatccctggaatgtttttgacttcctcatcgtaattggcagcata
attgacgtcattctcagtgagactaatcactatttctgtgatgcatggaatacatttgat
gccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtaaacccagctgaa
catacccaatgctctccctctatgaacgcagaggaaaactcccgcatctccatcaccttc
ttccgcctgttccgggtcatgcgcctggtgaagctgctgagccgtggggagggcatccgg
acgctgctatggaccttcatcaagtccttccaggccctgccgtacgtggccctcctgatc
gtgatgctgttcttcatctacgcggtgatcgggatgcaggtgtttgggaaaattgccctg
aatgataccacggagatcaaccggaacaacaactttcagaccttcccccaggccgtgctg
ctcctcttcaggtgtgccaccggggaggcctggcaggacatcatgctggcctgcatgcca
ggcaagaagtgtgccccagagtccgagcccagcaacagcacggagggtgaaacgccctgt
ggcagcagctttgctgtcttctacttcatcagcttctacatgctctgtgccttcctgatc
atcaacctctttgtagctgtcatcatggacaactttgactacctgacaagggactggtcc
atccttggtccccaccacctggatgagtttaaaagaatctgggcagagtatgaccctgaa
gcgaagggtcgtatcaaacacctggatgtggtgaccctcctccggcggattcagcccccc
ctaggttttgggaagctgtgccctcaccgcgtggcttgcaaacgcctggtctccatgaac
atgcctctgaacagcgacgggacagtcatgttcaatgccaccctgtttgccctggtcagg
acggccctgaggatcaaaacagaagggaacctagaacaagccaatgaggagctgcgggcg
atcatcaagaagatctggaagcggaccagcatgaagctgctggaccaggtggtgccccct
gcaggtgatgatgaggtcactgttggcaagttctacgccacgttcctgatccaggagtac
ttccggaagttcaagaagcgcaaagagcagggccttgtgggcaagccctcccagaggaac
gcgctgtctctgcaggctggcttgcgcacgctgcatgacatcgggcctgagatccgacgg
gccatctctggagatctcaccgctgaggaggagctggacaaggccatgaaggaggctgtg
tctgctgcttctgaagatgacatcttcaggagggccggtggcctgttcggcaaccacgtc
agctactaccaaagcgacagccggagcgccttcccccagaccttcaccactcagcgcccg
ctgcacatcaacaaggcgggcagcagccagggcgacactgagtcgccatcccacgagaag
ctggtggactctaccttcaccccgagcagctactcgtccaccggctccaacgccaacatc
aacaacgccaacaacaccgccctgggtcgcctccctcgccccactggctaccccagcacg
gtcagcactgtggagggccacgggccccccttgtcccctgccatccgggtgcaggaggtg
gcgtggaagctcagctccaacaggtgccactctcgggagagccagacagccatggcgggt
caggaggagacgtctcaggatgagacctatgaagtgaagatgaaccatgacacggaggcc
tgcagtgagcccagcctgctctccacagagatgctctcctaccaggatgacgaaaatcgg
caactgacgctcccagaggaggacaagagggacatccggcaatctccgaagaggggtttc
ctccgctctgcctcactaggtcgaagggcctccttccacctggaatgtctgaagcgacag
aaggaccgagggggagacatctctcagaagacagtcctgcccttgcatctggttcatcat
caggcattggcagtggcaggcctgagccccctcctccagagaagccattcccctgcctca
ttccccaggccttttgccaccccaccagccacacctggcagccgaggctggcccccacag
cccgtccccaccctgcggctggagggggtcgagtccagtgagaaactcaacagcagcttc
ccatccatccactgcggctcctgggctgagaccacccccgatggcgggggcagcagcgcc
gcccggaaagcccgacccgtctccctcatggtgcccggccaggctggggccccagggagg
cagttccacggcagtgccagcagcctggtggaagcggtcttgatttcagaaggactgggg
cagtttgctcaagatcccaagttcatcgaggtcaccacccaggagctggccgacgcctgc
gacatgaccatagaggagatggagagcgcggccgacaacatcctcagcgggggcgcccca
cagagccccaatggcgccctcttaccctttgtgaactgcagggacgcggggcaggaccga
gccgggggcgaagaggacgcgggctgtgtgcgcgcgcgggggcgcctgagtgaggaggag
ctccaggacagcagggtctacgtcagcagcctgtag

DBGET integrated database retrieval system