KEGG   Pongo abelii (Sumatran orangutan): 100444564
Entry
100444564         CDS       T01416                                 

Gene name
RASA2
Definition
(RefSeq) ras GTPase-activating protein 2 isoform X1
  KO
K08053  Ras GTPase-activating protein 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100444564 (RASA2)
   04014 Ras signaling pathway
    100444564 (RASA2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100444564 (RASA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100444564 (RASA2)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   100444564 (RASA2)
SSDB
Motif
Pfam: C2 RasGAP PH BTK PH_8 PH_3
Other DBs
NCBI-GeneID: 100444564
NCBI-ProteinID: XP_024100736
Ensembl: ENSPPYG00000014165
LinkDB
Position
3
AA seq 850 aa
MAAAAPAAAAAFSEAPAASATAEPEAGDEDSREVRVLQSLRGKICEAKNLLPYLGPHKMR
DCFCTINLDQEEVYRTQVVEKSLSPFFSEEFYFEIPRTFQYLSFYVYDKNVLQRDLRIGK
VAIKKEDLCNHSGKETWFSLQPVDSNSEVQGKVHLELKLNELITENGTVCQQLVVHIKAC
HGLPLINGQSCDPYATVSLVGPSRNDQKKTKVKKKTSNPQFNEIFYFEVTRSSSYTRKSQ
FQVEEEDIEKLEIRIDLWNNGNLVQDVFLGEIKVPVNVLRTDSSHQAWYLLQPRDNGNKS
SKTDDLGSLRLNICYTEDYVLPSEYYGSLKTLLLKSPDVQPISASAAYILSEICRDKNDA
VLPLVRLLLHHDKLVPFATAVAELDLKDTQDANTIFRGNSLATRCLDEMMKIVGGHYLKV
TLKPILDEICDSSKSCEIDPIKLKEGDNVENNKENLRYYVDKLFNTIVKSSMSCPTVMCD
IFYSLRQMATQRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHPDAQTIRTLTL
ISKTIQTLGSWGSLSKSKSSFKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGT
SEPVHLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSRELTYHKQPGSKDAIYTIPVKNILA
VEKLEESSFNKKNMFQVIHTEKPLYVQANNCVEANEWIDVLCRVSRCNQNRLSFYHPSVY
LNGNWLCCQETGENTLGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSLLKLQKMEEAC
GTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGS
KENPIVGKAS
NT seq 2553 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgcccgctgctgcggcggctttttccgaggcgccggcggcgagtgca
actgcagagcccgaggccggggacgaggacagtcgcgaggttcgagtgttgcagagcctg
cggggcaagatctgtgaagcaaaaaatttattgccatatcttggaccccacaaaatgaga
gattgtttctgtaccataaatttggaccaggaagaagtttatcgtacccaagttgtggaa
aaatctttaagcccatttttcagtgaagaattttactttgagattccaagaactttccag
tatttgtctttctatgtttatgataagaatgttttacaaagagatctccgtataggaaaa
gtagccatcaaaaaagaagacttgtgtaatcacagtggcaaagaaacttggttttcatta
cagcctgttgactccaattcagaggttcagggtaaagttcaccttgaattaaaactgaat
gaactgataacggagaatggaactgtatgccagcagcttgttgtacacatcaaggcatgc
catgggttgcctctcataaatggccaaagctgtgacccttatgcaacagtttctctagtg
ggcccttctaggaatgaccaaaagaagacaaaagtaaagaagaaaacaagcaatccgcag
tttaatgaaatcttttattttgaggtaaccagatccagtagttacaccagaaagtcccag
ttccaggtagaagaggaggacattgaaaagctagaaatcaggatcgacttgtggaacaat
ggaaacctagtccaagatgttttcctaggtgagattaaggttcctgtaaacgtattaaga
actgattcctctcatcaagcctggtacttgctacaaccaagagacaatggaaacaagtca
tccaaaactgatgacctggggtctctgcgattaaatatatgttatacagaagactacgtg
cttccttcagagtactatggttctttgaaaactttgctgctaaaatcaccagatgttcaa
ccaatatctgcctcagctgcttacattttgagtgaaatatgtcgagataaaaatgatgct
gttttgccccttgtacgactgctgctgcaccatgataaacttgttccttttgccactgct
gtggctgaattagacttgaaggatacacaagatgcaaacacaatttttagaggaaattcc
ttggctacccgatgtctggatgagatgatgaaaatagtgggagggcactacctgaaagta
acattaaaacctattcttgatgagatatgtgactcctcaaaatcctgtgaaatcgatcct
attaaattgaaagagggagataatgtagaaaataataaggagaatctgcgctactacgta
gacaagttattcaatacaattgtaaaatcaagtatgagctgccccactgtaatgtgtgat
atcttttattctctaaggcagatggctactcagagatttcctaatgaccctcatgttcag
tattctgcagtgagcagctttgtatttcttcgtttctttgctgtagccgtagtatcacct
catacttttcatttgcgacctcatcatccagatgcacagacaattagaacattaactctc
atctcaaaaactatacaaactttgggaagctgggggagtctgtccaaaagcaagtcaagt
ttcaaagagacattcatgtgtgaatttttcaaaatgtttcaagaagaaggatatattata
gcagttaaaaagttcttggatgaaatttcatctactgaaactaaagagtccagtggtacg
agtgagcctgtgcacctgaaagaaggtgagatgtataaaagagctcaaggaagaactcgg
attggaaaaaagaattttaagaaacgatggttctgcttaacaagcagagagctcacctac
cacaaacagccaggtagcaaagacgcaatctacacaattccagtaaaaaacattcttgct
gtggaaaaactggaagagagctctttcaacaagaaaaatatgttccaagtaatacatacg
gagaaaccactctatgtccaggcaaataactgtgtagaagctaatgaatggatagacgta
ctctgcagggtgagccgatgcaatcaaaacaggctcagtttttatcatccctctgtgtat
ctaaatggaaattggctctgctgtcaggagaccggtgaaaacactctcggctgcaagcca
tgtactgcaggtgtccctgcagacatccaaatagatattgatgaagacagagaaacagaa
agaatttattccctttttaccctcagtttacttaagctgcagaagatggaagaggcttgt
ggaactattgcagtctatcaaggaccacagaaagagcctgatgattattctaactttgta
atcgaggattctgtaacaacctttaagacaattcagcaaataaaaagcataattgagaag
ctggatgaacctcatgaaaaatataggaagaaaagatccagtagtgcaaaatatgggagc
aaggaaaatccaattgttgggaaagcatcttag

DBGET integrated database retrieval system