KEGG   Pongo abelii (Sumatran orangutan): 100447447
Entry
100447447         CDS       T01416                                 

Gene name
EZH2
Definition
(RefSeq) histone-lysine N-methyltransferase EZH2 isoform X1
  KO
K11430  [histone H3]-lysine27 N-trimethyltransferase EZH2 [EC:2.1.1.356]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00310  Lysine degradation
pon01100  Metabolic pathways
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100447447 (EZH2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100447447 (EZH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100447447 (EZH2)
Enzymes [BR:pon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.356  [histone H3]-lysine27 N-trimethyltransferase
     100447447 (EZH2)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100447447 (EZH2)
   Polycomb group proteins
    PRC2-EZH2 complex
     100447447 (EZH2)
SSDB
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC
Other DBs
NCBI-GeneID: 100447447
NCBI-ProteinID: XP_024105767
LinkDB
Position
7
AA seq 751 aa
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEW
KQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEEL
KEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHRKC
NYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRR
GRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQ
TPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESS
IIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCP
CVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWD
SKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRG
KVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRA
IQTGEELFFDYRYSQADALKYVGIEREMEIP
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgggccagactgggaagaaatctgagaagggaccagtttgttggcggaagcgtgtaaaa
tcagagtacatgcgactgagacagctcaagaggttcagacgggctgatgaagtaaagagt
atgtttagttccaatcgtcagaaaattttggaaagaacggaaatcttaaaccaagaatgg
aaacagcgaaggatacagcctgtgcacatcctgacttctgtgagctcattgcgcgggact
agggagtgttcggtgaccagtgacttggattttccaacacaagtcatcccattaaagact
ctgaatgcagttgcttcagtgcccataatgtattcttggtctcccctacagcagaatttt
atggtggaagatgaaactgttttacataacattccttatatgggagatgaagttttagac
caggatggtactttcattgaagaactaataaaaaattatgatggaaaagtacatggggat
agagaatgtgggtttataaatgatgaaatttttgtggagttggtgaatgcccttggtcaa
tataatgatgatgacgatgacgatgatggagacgatcctgaagaaagagaagaaaagcag
aaagatctggaggatcaccgagatgataaagaaagccgcccacctcggaaatttccttct
gataaaatttttgaagccatttcctcaatgtttccagataagggcacagcagaagaacta
aaggaaaaatataaagaactcaccgaacagcagctcccaggcgcacttcctcctgaatgt
acccccaacatagatggaccaaacgctaaatctgttcagagagagcaaagcttacactcc
tttcatacgcttttctgtaggcgatgttttaaatatgactgcttcctacatcgtaagtgc
aattattcctttcatgcaacacccaacacttataagcggaagaacacagaaacagctcta
gacaacaaaccttgtggaccacagtgttaccagcatttggagggagcaaaggagttcgct
gctgctctcaccgctgagcggataaagaccccaccaaaacgcccaggaggccgcagaaga
ggacggcttcccaataacagtagcaggcccagcacccccaccattaatgtgctggaatca
aaggatacagacagtgatagggaagcagggactgaaacggggggagagaacaatgataaa
gaagaagaagagaagaaagatgaaacttcgagctcctctgaagcaaattctcggtgtcaa
acaccaataaagatgaagccaaatattgaacctcctgagaatgtggagtggagtggtgct
gaagcctcaatgtttagagtcctcattggcacttactatgacaatttctgtgccattgct
aggttaattgggaccaaaacatgtagacaggtgtatgagtttagagtcaaagaatctagc
atcatagctccagctcccgctgaggatgtggatactcctccaaggaaaaagaagaggaaa
caccggttgtgggctgcgcactgcagaaagatacagctgaaaaaggacggctcctctaac
catgtttacaactatcaaccctgtgatcatccacggcagccttgtgacagttcgtgccct
tgtgtgatagcacaaaatttttgtgaaaagttttgtcaatgtagttcagagtgtcaaaac
cgctttccgggatgccgctgcaaagcacagtgcaacaccaagcagtgcccgtgctacctg
gctgtccgagagtgtgaccctgacctctgtcttacttgtggagccgctgaccattgggac
agtaaaaatgtgtcctgcaagaactgcagtattcagcggggctccaaaaagcatctattg
ctggcaccatctgatgtggcaggctgggggatttttatcaaagatcctgtgcagaaaaat
gaattcatctcagaatactgtggagagattatttctcaagatgaagctgacagaagaggg
aaagtatatgataaatacatgtgcagctttctgttcaacttgaacaatgattttgtggtg
gatgcaacccgcaagggtaacaaaattcgttttgcaaatcattcagtaaatccaaactgc
tatgcaaaagttatgatggttaacggtgatcacaggataggtatttttgccaagagagcc
atccagactggcgaagagctgttttttgattacagatacagccaggctgatgccctgaag
tatgtcggcatcgaaagagaaatggaaatcccttga

DBGET integrated database retrieval system