KEGG   Pongo abelii (Sumatran orangutan): 100449496
Entry
100449496         CDS       T01416                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X5
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01523  Antifolate resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04064  NF-kappa B signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04668  TNF signaling pathway
pon04920  Adipocytokine signaling pathway
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05212  Pancreatic cancer
pon05215  Prostate cancer
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05340  Primary immunodeficiency
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100449496 (IKBKG)
   04014 Ras signaling pathway
    100449496 (IKBKG)
   04064 NF-kappa B signaling pathway
    100449496 (IKBKG)
   04668 TNF signaling pathway
    100449496 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100449496 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100449496 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100449496 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100449496 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100449496 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100449496 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100449496 (IKBKG)
   04660 T cell receptor signaling pathway
    100449496 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100449496 (IKBKG)
   04659 Th17 cell differentiation
    100449496 (IKBKG)
   04657 IL-17 signaling pathway
    100449496 (IKBKG)
   04662 B cell receptor signaling pathway
    100449496 (IKBKG)
   04062 Chemokine signaling pathway
    100449496 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100449496 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100449496 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100449496 (IKBKG)
   05203 Viral carcinogenesis
    100449496 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100449496 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100449496 (IKBKG)
   05221 Acute myeloid leukemia
    100449496 (IKBKG)
   05220 Chronic myeloid leukemia
    100449496 (IKBKG)
   05215 Prostate cancer
    100449496 (IKBKG)
   05222 Small cell lung cancer
    100449496 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100449496 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100449496 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100449496 (IKBKG)
   05135 Yersinia infection
    100449496 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100449496 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100449496 (IKBKG)
   05162 Measles
    100449496 (IKBKG)
   05164 Influenza A
    100449496 (IKBKG)
   05161 Hepatitis B
    100449496 (IKBKG)
   05160 Hepatitis C
    100449496 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100449496 (IKBKG)
   05163 Human cytomegalovirus infection
    100449496 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100449496 (IKBKG)
   05169 Epstein-Barr virus infection
    100449496 (IKBKG)
   05165 Human papillomavirus infection
    100449496 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100449496 (IKBKG)
   05142 Chagas disease
    100449496 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100449496 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100449496 (IKBKG)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100449496 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Bacillus_HBL LLC1
Other DBs
NCBI-GeneID: 100449496
NCBI-ProteinID: XP_002832358
Ensembl: ENSPPYG00000020886
UniProt: A0A2J8RM19
LinkDB
Position
X
AA seq 419 aa
MSRHLWKSQLCEMVQPSGGPAADQDVLGEDSPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQMLRERCEELLHFQASQREEKEFLMCKFQEARKLVERLSLEKLDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagtaggcacctctggaagagccaactgtgtgagatggtgcagcctagtggtggcccg
gcagcagatcaggacgtgctgggtgaagactctcctctggggaagccagccatgctgcac
ctgccttcagaacagggcgctcctgagaccctccagcgctgcctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgctgcgggagcgctgcgaggagcttctg
catttccaagccagccagagggaggagaaggagttcctcatgtgcaaattccaggaggcc
aggaaactggtggagagactcagcctggagaagctcgacctgaagaggcagaaggagcag
gctctgcgggaggtggagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tctgtgaaagcccaggtgacgtccttgctcggggagctgcaggagagccagagtcgcttg
gaggctgccactaaggaatgccaggctctggagggccgggcccgggcggccagcgagcag
gcgcggcagctggagagtgagcgtgaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagggccagagcgtggaggccgcgctccgcatggagcgccaggccgcc
tcggaggagaagaggaagctggcccagttgcaggtggcctatcaccagctcttccaagaa
tacgacaaccacatcaagagcagcgtggtgggcagcgagcggaagcgaggaatgcagctg
gaagatctcaaacagcagctccagcaggccgaggaggccctggtggccaaacaggaggtg
atcgataagctgaaggaggaggccgagcagcacaagattgtgatggagaccgttccggtg
ctgaaggcccaggcggatatctacaaggcagacttccaggctgagaggcaggcccgggag
aagctggctgagaagaaggagctcctgcaggagcagctggagcagctgcagagggagtac
agcaaactgaaggccagctgtcaggagtcggccaggatcgaggacatgaggaagcggcat
gttgaggtctcccaggcccccttgccccctgcccccgcctacctctcctctcccctggcc
ctgcccagccagaggaggagcccccccgaggagccacctgacttctgctgtcccaagtgc
cagtatcaggcccctgatatggacaccctgcagatacatgtcatggagtgcattgagtag

DBGET integrated database retrieval system