Pongo abelii (Sumatran orangutan): 100450292 Help Entry 100450292         CDS       T01416                                  Symbol JUN Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon01522   Endocrine resistance pon04010   MAPK signaling pathway pon04012   ErbB signaling pathway pon04024   cAMP signaling pathway pon04137   Mitophagy - animal pon04210   Apoptosis pon04310   Wnt signaling pathway pon04380   Osteoclast differentiation pon04510   Focal adhesion pon04530   Tight junction pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04625   C-type lectin receptor signaling pathway pon04657   IL-17 signaling pathway pon04658   Th1 and Th2 cell differentiation pon04659   Th17 cell differentiation pon04660   T cell receptor signaling pathway pon04662   B cell receptor signaling pathway pon04668   TNF signaling pathway pon04722   Neurotrophin signaling pathway pon04912   GnRH signaling pathway pon04915   Estrogen signaling pathway pon04921   Oxytocin signaling pathway pon04926   Relaxin signaling pathway pon04932   Non-alcoholic fatty liver disease pon04933   AGE-RAGE signaling pathway in diabetic complications pon05030   Cocaine addiction pon05031   Amphetamine addiction pon05132   Salmonella infection pon05133   Pertussis pon05135   Yersinia infection pon05140   Leishmaniasis pon05142   Chagas disease pon05161   Hepatitis B pon05162   Measles pon05166   Human T-cell leukemia virus 1 infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05203   Viral carcinogenesis pon05207   Chemical carcinogenesis - receptor activation pon05208   Chemical carcinogenesis - reactive oxygen species pon05210   Colorectal cancer pon05211   Renal cell carcinoma pon05224   Breast cancer pon05231   Choline metabolism in cancer pon05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pon05321   Inflammatory bowel disease pon05323   Rheumatoid arthritis pon05417   Lipid and atherosclerosis pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100450292 (JUN)    04012 ErbB signaling pathway     100450292 (JUN)    04310 Wnt signaling pathway     100450292 (JUN)    04668 TNF signaling pathway     100450292 (JUN)    04024 cAMP signaling pathway     100450292 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100450292 (JUN)   09143 Cell growth and death    04210 Apoptosis     100450292 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100450292 (JUN)    04530 Tight junction     100450292 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100450292 (JUN)    04621 NOD-like receptor signaling pathway     100450292 (JUN)    04625 C-type lectin receptor signaling pathway     100450292 (JUN)    04660 T cell receptor signaling pathway     100450292 (JUN)    04658 Th1 and Th2 cell differentiation     100450292 (JUN)    04659 Th17 cell differentiation     100450292 (JUN)    04657 IL-17 signaling pathway     100450292 (JUN)    04662 B cell receptor signaling pathway     100450292 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     100450292 (JUN)    04915 Estrogen signaling pathway     100450292 (JUN)    04921 Oxytocin signaling pathway     100450292 (JUN)    04926 Relaxin signaling pathway     100450292 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     100450292 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     100450292 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100450292 (JUN)    05207 Chemical carcinogenesis - receptor activation     100450292 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     100450292 (JUN)    05203 Viral carcinogenesis     100450292 (JUN)    05231 Choline metabolism in cancer     100450292 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100450292 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     100450292 (JUN)    05211 Renal cell carcinoma     100450292 (JUN)    05224 Breast cancer     100450292 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100450292 (JUN)    05170 Human immunodeficiency virus 1 infection     100450292 (JUN)    05161 Hepatitis B     100450292 (JUN)    05171 Coronavirus disease - COVID-19     100450292 (JUN)    05162 Measles     100450292 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     100450292 (JUN)    05169 Epstein-Barr virus infection     100450292 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     100450292 (JUN)    05135 Yersinia infection     100450292 (JUN)    05133 Pertussis     100450292 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100450292 (JUN)    05142 Chagas disease     100450292 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     100450292 (JUN)    05321 Inflammatory bowel disease     100450292 (JUN)   09165 Substance dependence    05030 Cocaine addiction     100450292 (JUN)    05031 Amphetamine addiction     100450292 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100450292 (JUN)    05418 Fluid shear stress and atherosclerosis     100450292 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100450292 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     100450292 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100450292 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pon03000]     100450292 (JUN) Transcription factors [BR:pon03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     100450292 (JUN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 ZapB PspA_IM30 Fib_alpha DUF3450 TFIIA FlaC_arch Motif Other DBs NCBI-GeneID:  100450292 NCBI-ProteinID:  XP_002810809 Ensembl:  ENSPPYG00000001295 UniProt:  H2N785 LinkDB All DBs Position 1:174355258..174357853 Genome browser AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcgttcctcccg tccgagagcggaccttatggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccagtggggagcctgaagccgcacctccgtgcgaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcaacggggcg ggcatggtggctcccgcggtagcctcggtggcagggggcagcggcagcggcggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccaggcgcg ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa ccccagcagcagcagcagccgccgcagccgccgcaccacctgccccagcagatgcccgtg cagcacccgcggctgcaggccctaaaggaggagcctcagacagtgcccgagatgccgggc gagacaccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagagg aagcgcatgaggaaccgcatcgctgcctccaagtgccgaaaaaggaagctggagagaatc gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacattttga

Pongo abelii (Sumatran orangutan): 100462290 Help Entry 100462290         CDS       T01416                                  Symbol FOS Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon01522   Endocrine resistance pon04010   MAPK signaling pathway pon04024   cAMP signaling pathway pon04210   Apoptosis pon04380   Osteoclast differentiation pon04620   Toll-like receptor signaling pathway pon04657   IL-17 signaling pathway pon04658   Th1 and Th2 cell differentiation pon04659   Th17 cell differentiation pon04660   T cell receptor signaling pathway pon04662   B cell receptor signaling pathway pon04668   TNF signaling pathway pon04713   Circadian entrainment pon04725   Cholinergic synapse pon04728   Dopaminergic synapse pon04915   Estrogen signaling pathway pon04917   Prolactin signaling pathway pon04921   Oxytocin signaling pathway pon04926   Relaxin signaling pathway pon04928   Parathyroid hormone synthesis, secretion and action pon04932   Non-alcoholic fatty liver disease pon04935   Growth hormone synthesis, secretion and action pon05031   Amphetamine addiction pon05132   Salmonella infection pon05133   Pertussis pon05135   Yersinia infection pon05140   Leishmaniasis pon05142   Chagas disease pon05161   Hepatitis B pon05162   Measles pon05166   Human T-cell leukemia virus 1 infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05207   Chemical carcinogenesis - receptor activation pon05208   Chemical carcinogenesis - reactive oxygen species pon05210   Colorectal cancer pon05224   Breast cancer pon05231   Choline metabolism in cancer pon05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pon05323   Rheumatoid arthritis pon05417   Lipid and atherosclerosis pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100462290 (FOS)    04668 TNF signaling pathway     100462290 (FOS)    04024 cAMP signaling pathway     100462290 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100462290 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100462290 (FOS)    04660 T cell receptor signaling pathway     100462290 (FOS)    04658 Th1 and Th2 cell differentiation     100462290 (FOS)    04659 Th17 cell differentiation     100462290 (FOS)    04657 IL-17 signaling pathway     100462290 (FOS)    04662 B cell receptor signaling pathway     100462290 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     100462290 (FOS)    04917 Prolactin signaling pathway     100462290 (FOS)    04921 Oxytocin signaling pathway     100462290 (FOS)    04926 Relaxin signaling pathway     100462290 (FOS)    04935 Growth hormone synthesis, secretion and action     100462290 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     100462290 (FOS)   09156 Nervous system    04725 Cholinergic synapse     100462290 (FOS)    04728 Dopaminergic synapse     100462290 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     100462290 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     100462290 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100462290 (FOS)    05207 Chemical carcinogenesis - receptor activation     100462290 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     100462290 (FOS)    05231 Choline metabolism in cancer     100462290 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100462290 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     100462290 (FOS)    05224 Breast cancer     100462290 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100462290 (FOS)    05170 Human immunodeficiency virus 1 infection     100462290 (FOS)    05161 Hepatitis B     100462290 (FOS)    05171 Coronavirus disease - COVID-19     100462290 (FOS)    05162 Measles     100462290 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     100462290 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     100462290 (FOS)    05135 Yersinia infection     100462290 (FOS)    05133 Pertussis     100462290 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100462290 (FOS)    05142 Chagas disease     100462290 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     100462290 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     100462290 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100462290 (FOS)    05418 Fluid shear stress and atherosclerosis     100462290 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100462290 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100462290 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pon03000]     100462290 (FOS)    04131 Membrane trafficking [BR:pon04131]     100462290 (FOS) Transcription factors [BR:pon03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     100462290 (FOS) Membrane trafficking [BR:pon04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100462290 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  100462290 NCBI-ProteinID:  XP_002824996 Ensembl:  ENSPPYG00000006002 UniProt:  A0A6D2W783 LinkDB All DBs Position 15:79531014..79535965 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcccgctgcagcagcgcg tccccggccggggatagcctctcctactaccactcacccgccgactccttctccagcatg ggctcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc attcccacggtcactgccatctcgaccagtccggacctgcagtggctggtgcagcctgcc ctcgtctcctccgtggccccatcgcagaccagagcccctcaccctttcggagtccccacc ccctccgctggggcttactccagggctggcgttgtgaagaccatgacaggaggccgagcg cagagcattggcaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag accgagattgccaacctgctaaaggagaaggaaaaactagagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacctgggcttcccagaagagatgtctgtggcttcc cttgatctgactgggggcctgccagaggttgccaccccggagtctgaggaggccttcacc ctgcctctcctcaatgaccctgagcccaagccctcagtggaacctgtcaagagcatcagc agcatggagctgaaggccgagccgtttgatgacttcctgttcccagcatcatccaggccc agcggctctgagacagcccgctctgtgccagacatggacctatctgggtccttttatgca gcagactgggagcctctgcacagtggctccctgggaatggggcccatggccacagagctg gagcccctgtgcactccggtggtcacctgtactcccagctgcactgcttacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgcgcagctgcccaccgcaag ggcagcagcagcaatgagccttcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system