KEGG   Pongo abelii (Sumatran orangutan): 100450941
Entry
100450941         CDS       T01416                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X2
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04062  Chemokine signaling pathway
pon04064  NF-kappa B signaling pathway
pon04066  HIF-1 signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04670  Leukocyte transendothelial migration
pon04722  Neurotrophin signaling pathway
pon04750  Inflammatory mediator regulation of TRP channels
pon04919  Thyroid hormone signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon05012  Parkinson disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05135  Yersinia infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05223  Non-small cell lung cancer
pon05225  Hepatocellular carcinoma
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
pon_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100450941 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100450941 (PLCG1)
   04014 Ras signaling pathway
    100450941 (PLCG1)
   04015 Rap1 signaling pathway
    100450941 (PLCG1)
   04370 VEGF signaling pathway
    100450941 (PLCG1)
   04064 NF-kappa B signaling pathway
    100450941 (PLCG1)
   04066 HIF-1 signaling pathway
    100450941 (PLCG1)
   04020 Calcium signaling pathway
    100450941 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100450941 (PLCG1)
   04072 Phospholipase D signaling pathway
    100450941 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100450941 (PLCG1)
   04660 T cell receptor signaling pathway
    100450941 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100450941 (PLCG1)
   04659 Th17 cell differentiation
    100450941 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100450941 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100450941 (PLCG1)
   04670 Leukocyte transendothelial migration
    100450941 (PLCG1)
   04062 Chemokine signaling pathway
    100450941 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100450941 (PLCG1)
   04919 Thyroid hormone signaling pathway
    100450941 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100450941 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100450941 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    100450941 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450941 (PLCG1)
   05206 MicroRNAs in cancer
    100450941 (PLCG1)
   05205 Proteoglycans in cancer
    100450941 (PLCG1)
   05231 Choline metabolism in cancer
    100450941 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100450941 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100450941 (PLCG1)
   05214 Glioma
    100450941 (PLCG1)
   05223 Non-small cell lung cancer
    100450941 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100450941 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    100450941 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100450941 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100450941 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100450941 (PLCG1)
   05171 Coronavirus disease - COVID-19
    100450941 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100450941 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100450941 (PLCG1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100450941 (PLCG1)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100450941 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100450941 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 100450941
NCBI-ProteinID: XP_009231862
Ensembl: ENSPPYG00000011011
UniProt: H2P1Y0
LinkDB
Position
20
AA seq 1291 aa
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKVKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAISVEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQIINPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFED
FRISQEHLTDHFDSRERRAPRRTRVNGDNRL
NT seq 3876 nt   +upstreamnt  +downstreamnt
atggcgggcgctgcgtccccttgcgccaacggctgcgggcccggcgccccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcgacccgagcggaagaccttccaggtcaagctggagacgcgccagatc
acgtggagccgtggtgccgacaagatcgagggggccattgatattcgtgaaattaaggag
atccgcccagggaagacctcacgggactttgatcgctatcaagaggacccagctttccgg
ccggaccagtcacattgctttgtcattctctatggaatggaatttcgcctgaaaacgctg
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggctg
atggaggatacattgcaggcacccacaccgctgcagattgagaggtggctccggaagcag
ttttactcagtggatcggaatcgtgaggatcgtatatcagccaaggacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcggctgacggac
ctggagcagcgcagcggggacatcacctacgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcttggaagccagtactctgagggct
ggggagcggccggagctttgccgagtgtcccttcctgagttccagcagttccttcttgac
taccagggggagctgtgggctgttgatcgcctccaggtgcaggagttcatgctcagcttc
ctccgagaccccttacgagagatcgaggagccatacttcttcctggatgagtttgtcacc
ttcctgttctccaaagagaacagtgtgtggaactcacagctggatgcagtatgcccggac
accatgaacaaccctctttcccactactggatctcctcctcgcacaacacgtacctgacc
ggggaccagttctccagtgagtcctccttggaagcctatgctcgctgcctgcggatgggc
tgtcgctgcattgagttggactgctgggacggcccggatgggatgccagttatttaccat
ggtcacacccttaccaccaagatcaagttctcagatgtcctgcataccatcaaggagcat
gcctttgtggcctcagagtacccagtcatcctgtccattgaggaccactgcagcattgcc
cagcagaggaacatggcccagtacttcaagaaggtgctgggggacacactcctcaccaag
cccgtggagatctccgccgatgggctcccctcacccaaccagcttaagaggaagatcctt
atcaagcacaagaagctggctgagggcagtgcctatgaggaggtgcctacatccatgatg
tactctgagaacgacatcagcaactccatcaagaatggcatcctctacctggaggaccct
gtgaaccacgaatggtatccccactactttgttctgaccagcagcaagatctactactct
gaggagaccagcagtgaccagggcaacgaggatgaggaggagcccaaggaggtcagcagc
agcacagagctgcactccaatgagaagtggttccatgggaagctaggggcagggcgtgac
gggcgtcacatcgctgagcgcctgctcactgagtactgcatcgagactggagcccctgac
ggctccttcctcgtgcgagagagtgagaccttcgtgggcgactacacgctctctttctgg
cggaacgggaaagtccagcactgccgtatccactcccggcaagatgctgggacccccaag
ttcttcttgacagacaacctcgtctttgactccctctatgacctcatcacacactaccag
caggtgcccctgcgctgtaatgagtttgagatgcgactttcagagcctgtcccacagacc
aacgcccacgagagcaaagagtggtaccacgcgagcctgaccagagcacaggctgagcac
atgctaatgcgcgtccctcgtgatggggccttcctggtgcggaagcggaatgagcccaac
tcatatgccatctctttccgggctgagggcaagatcaagcattgccgtgtccagcaagag
ggccagacagtgatgctagggaactcggagttcgacagccttgttgacctcatcagctac
tatgagaaacacccactataccgcaagatgaagctgcgctatcccatcaacgaggaggca
ttggagaagattggcacagctgagcctgactacggggccctgtatgagggacgcaaccct
ggcttctatgtagaggcaaaccctatgccaactttcaagtgtgcggtcaaagccctcttt
gactacaaggcccagagggaggacgagctgaccttcaccaagagcgccatcatccagaat
gtggagaagcaagagggaggctggtggcgaggggactacggagggaagaagcagctgtgg
ttcccatcaaactatgtggaagagatggtcaaccccgtggccctggagccggagagggag
cacttggacgagaacagccccctaggggacttgctgcggggcgtcttggatgtgccggct
tgtcagattgccatccgtcctgagggcaagaacaaccggctcttcgtcttctccatcagc
atggcgtcggtggcccactggtccctggatgttgctgccgactcacaggaggagctgcag
gactgggtgaaaaagatccgtgaagtggcccagaccgcagatgccaggctcactgaaggg
aagataatggaacggaggaagaagattgccctggagctctctgaacttgtcgtctactgc
cggcctgttcccttcgatgaagagaagattggcacagaacgtgcttgctaccgggacatg
tcatccttcccggaaaccaaggctgagaaatacgtgaacaaggtcaaaggcaagaagttc
cttcagtacaatcgactgcagctctcccgcatctaccccaagggccagcgactggattcc
tccaactacgatcctttgcccatgtggatctgtggcagtcagctcgtggccctcaacttc
cagacccctgacaagcctatgcagatgaaccaggccctcttcatgacgggcaggcactgt
ggctacgtgctgcagccaagcaccatgcgggatgaggccttcgacccctttgacaagagc
agcctccgcgggctggagccatgtgccatctctgttgaggtgctgggggcccgacatctg
ccaaagaatggccgaggcattgtgtgtccttttgtggagatagaggtggctggagctgag
tatgacagcaccaagcagaagacagagtttgtggtggacaatggactcaaccctgtatgg
ccagccaagcccttccacttccagatcattaaccctgaatttgcctttctgcgcttcgtg
gtgtatgaggaagacatgtttagtgaccagaatttcttggctcaggctactttcccagta
aaaggcctgaagacaggatacagagcagtgcctttgaagaacaactacagtgaggacctg
gagttggcctccctgctgatcaagattgacattttccctgccaagcaggagaatggtgac
ctcagtcccttcagtggtacgtccctgcgggagcggggctcagatgcctcaggccagctg
tttcacggccgagcccgggaaggctcctttgaatcccgctaccagcagccatttgaggac
ttccgcatctcccaggagcatctcacagaccattttgacagtcgagaacgaagggcccca
agaaggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system