KEGG   Pongo abelii (Sumatran orangutan): 100451794
Entry
100451794         CDS       T01416                                 

Gene name
AOX4
Definition
(RefSeq) LOW QUALITY PROTEIN: aldehyde oxidase 4
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00280  Valine, leucine and isoleucine degradation
pon00350  Tyrosine metabolism
pon00380  Tryptophan metabolism
pon00750  Vitamin B6 metabolism
pon00760  Nicotinate and nicotinamide metabolism
pon00830  Retinol metabolism
pon00982  Drug metabolism - cytochrome P450
pon01100  Metabolic pathways
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100451794 (AOX4)
   00350 Tyrosine metabolism
    100451794 (AOX4)
   00380 Tryptophan metabolism
    100451794 (AOX4)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100451794 (AOX4)
   00760 Nicotinate and nicotinamide metabolism
    100451794 (AOX4)
   00830 Retinol metabolism
    100451794 (AOX4)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100451794 (AOX4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100451794 (AOX4)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100451794 (AOX4)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C CO_deh_flav_C Fer2_2 Fer2
Other DBs
NCBI-GeneID: 100451794
NCBI-ProteinID: XP_009236227
LinkDB
Position
2B
AA seq 1335 aa
MPSLPHSDELIFFVNGRKVIQRNADPEVNLLFYVRKRLHLTGTKYACGGGGCGACTVMVS
RYNPTTKTIHHYPATACLVPVCSLYGAAVTTVEGVGSIKTRIHPAQERLAKCHGTQCGFC
SPGTVMSIYILLRNHPEPTPEQITKALGGNLCRCTGYRPIVESGKTFCVESTVCQLKGSG
KCCMDQEEGSFVNRWEKMCTKLYDEDEFQPLDPSQEPIFPPELIRMAEDPNKRRLTFQGE
RTTWITPVTLNDLLELKANFPKALLVMGNTEVGPSIKFKNEFHPVFISPLGLPELYFVNT
TDDGVTTGAGYSLAQLNDALHFIVSEQPKEKTKTHRALLKHLRTLAGAQIRNMAILGGHV
VSRPNFSDLNPILAAGNATVNLISKEGQRQIPLNGPFLQRSPEADLKSEEIASSVYIPYS
TQWHFVFGLRMAQCQENAFAIVNAGMSVKFEDGTNTIKELQMFYGSMGPTVVSASQTCKQ
LIGRQWDNQMLRDACRWVLDEIYIPPAAEGGMVEYRRTLIISLLFKFYLKVRXGLNQMDP
QKFPDIPEQFMSVLEDFPIETPQGIQMFQCVDPYQPPQDPVGHPVMHQSAIKHTTGEAIY
VDDMPRIDQELFLAPITSTRAHAKIISIDISEALALPGVVDVITAEDVPGDNNYQGEVFY
AQNEVICMGQIVSTVAADTYAHAREAAKKVKIAYEDIEPRIITIEQALEHNSFLFDEKKI
EQGNVEQAFKYVDQIIEGEVHVEGQEHFYMETSSILALPKEEDKEMVLHLGTQYPTRVQE
YVAAALNVPRNRIACRMKRAGGAFGGKVTKPALLGAVSAVAANKTGRPIRFILERGDDML
ITAGRHPLLGKYKIGFMNNGVIKAADVEYYVNGGCTPDESERVVEFIVLKSENSYCIPNF
RCRGRACKTNLPSNTAFRGFGFPQGTVVVEAYITAVASQCNLPPEEVRXINIYKRISKTA
FKQTFNPEPLRRCWKECLEKSSFYARKLAAEEFNKKNYWKKRGLAGVPMKFSIGIPTAYY
NQAAALVHIYLDGSVLVTHGGCELGQGLYPKMIQVASRELNIPQSYIHLSETSTVTVPNG
VFTSGSMGTDINGKAVQNACQTLMAHLHPIIRKNPEGKWEDWMSIAKAFEESISLSATGY
FKGYQTNMDWEKGEGNSYPYYVYGAACSEVEVDCLTGAHKLLRTDIFMDAAFSINPALDI
GQIEGAFIQGMGFYTIEELKYSPEVVLYSRSPDDYKIPTVTEIAEEFYVTLVRSQNPIAI
YSSKELGEAGMFLGSSVLFAIYDAVAAARRERGLSXVLSSLATPEMIRMTCVDQFTDMIS
RDDPSTFTPWSIRVS
NT seq 4008 nt   +upstreamnt  +downstreamnt
atgccttcccttccccattctgatgagctgattttttttgtgaatggaagaaaggtgata
cagaggaatgctgatcctgaagtaaatctactgttctacgtgaggaaaagactccatctt
acaggcactaaatacgcctgtggaggaggtggctgcggtgcctgcacagtgatggtgtca
agatacaaccccacaaccaagacgatccaccattatccagcaacggcgtgcctggtaccc
gtctgctctctgtatggggctgcagtcaccaccgtggaaggtgtgggaagcatcaaaacc
aggattcaccctgcgcaggaaagacttgccaagtgtcatggcacacaatgtggattctgc
agcccagggacggtaatgtccatctacatactgctgaggaatcacccggagccaacccct
gagcagatcaccaaagctctgggaggtaatttgtgccgctgcactggataccgaccaatt
gtagaaagtggaaaaactttctgtgtggaatcaactgtttgtcaactgaaaggatcggga
aaatgttgcatggatcaagaagaagggtctttcgtgaatagatgggaaaaaatgtgcacc
aaactgtatgatgaagacgaattccagcctttggatccatcccaggagcctatattccct
cctgaactgataagaatggcagaagatccaaacaagagaaggctgaccttccaaggggag
agaaccacatggatcacccctgtgaccctgaacgaccttctggagctgaaagccaatttc
cccaaagccctgcttgtcatgggaaacacagaagtgggacccagcattaaattcaaaaat
gaattccatccagtttttatatctccacttgggcttccagaactatattttgtgaacacc
acagatgatggggtgacaacaggtgcgggatacagcctggcccagttgaatgatgcctta
cattttatcgtttcggagcaaccgaaggagaagactaagacccatcgagctctgctgaag
catctgaggacacttgcaggagcccagattaggaatatggccattttaggaggacatgtg
gtgagccggcctaatttttctgacctaaaccccattttagcagcaggaaatgctaccgtc
aatttgatatccaaagaaggacaacggcagattcctttaaatggtcctttccttcagaga
tcacctgaggccgacttgaaatcagaagagattgcgtcgtctgtttatattccctactcc
actcagtggcactttgtatttggactccgaatggcccagtgtcaggagaatgcatttgcc
attgtcaatgctgggatgagcgtgaagtttgaagatggcacaaacacaatcaaggaactt
caaatgttctatggaagcatgggccccactgttgtctctgcaagccaaacctgcaagcag
cttattgggaggcaatgggataatcaaatgctgagggatgcctgccgatgggtcctggat
gagatctacatcccaccagcagctgagggtggcatggtggagtacaggcgaaccctcatc
atcagcctcctcttcaaattctacctgaaagtgaggtgaggactgaatcaaatggatccc
cagaagtttcccgacatcccagaacagttcatgagtgttctagaagactttccaattgaa
acaccccaaggaattcagatgtttcagtgtgtggatccctaccaacccccacaagatcca
gttggacacccagtcatgcaccagtcggccattaaacacaccacaggggaagctatatat
gttgatgacatgccccgcatcgaccaagaactcttcctggctccaatcaccagcaccaga
gctcatgcaaagatcatatcaattgatatttcagaagccctggcacttccaggtgttgtt
gatgtgataacagcagaggatgttccaggagataataactatcaaggagaggttttctat
gcacagaatgaggtaatttgcatgggtcagatcgtcagcactgtggccgctgatacctat
gctcatgcaagagaggcagctaaaaaagtgaagatcgcttatgaagacatagagccaagg
attatcacaatagagcaagccctagagcacaattcatttctttttgatgagaaaaaaatc
gagcaaggaaatgtagagcaagcctttaaatatgttgaccaaatcattgaaggtgaggtc
catgtggaaggacaggaacatttttacatggaaacatcatctatcctggctctcccaaaa
gaagaagataaagaaatggtattacaccttggaacacagtatccaacccgtgtgcaggaa
tatgtggctgcagcactgaacgtcccaaggaatagaatcgcctgccgcatgaaaagagct
ggaggagcgtttggagggaaagtgaccaagcctgctctgctaggagctgtcagtgctgtg
gccgccaacaagactggccgtccaatccggtttatcctagaacgtggtgatgacatgctg
ataactgctggccgccacccactcctcggaaaatacaaaattggattcatgaacaatggt
gtgataaaagctgctgatgtcgaatattatgtcaatggcgggtgcactcctgatgagtct
gagcgggtggtggagttcattgtgctgaaatctgaaaactcatactgtattcctaatttc
cggtgccggggtagggcttgcaaaacaaatttgccatccaacacagcctttcgaggattt
ggctttcctcagggtacggtggtggtcgaagcttacataactgctgtggcatctcaatgc
aacttaccccctgaagaggttagataaataaacatatataagagaattagcaaaacagcc
tttaagcagacatttaatccagagccattgcgaagatgctggaaagaatgtctggagaaa
tcttcattctatgctaggaaactggccgcagaggaatttaacaaaaagaattactggaag
aagaggggacttgccggagtccccatgaaattttccattgggatccccacagcttactac
aatcaggcggccgctctcgttcacatctatctagatggctctgtcttggtgactcatggt
ggctgtgaactgggacaaggcctgtaccccaaaatgattcaggtggctagtcgcgaactc
aatatcccccagtcatacatacacctgtccgaaacaagcacagtcacggtgcccaatggc
gtcttcacatcaggatcaatggggacagacatcaatggaaaggctgtgcaaaatgcctgc
caaactcttatggcccatcttcatcccatcatcaggaaaaaccctgaaggaaaatgggag
gattggatgagtattgcaaaagcctttgaagaatccatcagtctctcagctactggatat
ttcaaaggctaccaaacaaatatggactgggagaagggggaaggtaattcttacccgtat
tatgtttatggagcagcctgttctgaggttgaagtcgactgtctcacgggggctcataag
cttcttaggaccgacatcttcatggatgccgctttcagcataaacccagccctggatatt
ggacagattgagggagcatttattcaaggcatgggattctataccatagaagaactgaaa
tactccccagaagttgtgctttattctcggagtccagatgactacaaaatccccactgtc
actgagatagcagaagagttctatgtcactttggtgcgttcccaaaatcccatagccatc
tactcatccaaggaattgggtgaggctggaatgttcttggggtcctccgtgttgtttgcc
atatacgacgcggtggctgctgcccgcagagagagggggctgtctnncgtcctgagtagc
ctggcaacccctgagatgattcggatgacctgtgtggatcagttcaccgacatgatttcc
agagatgacccttcgacatttacaccttggtccatccgtgtgtcttaa

KEGG   Pongo abelii (Sumatran orangutan): 100939468
Entry
100939468         CDS       T01416                                 

Gene name
AOX1
Definition
(RefSeq) aldehyde oxidase
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00280  Valine, leucine and isoleucine degradation
pon00350  Tyrosine metabolism
pon00380  Tryptophan metabolism
pon00750  Vitamin B6 metabolism
pon00760  Nicotinate and nicotinamide metabolism
pon00830  Retinol metabolism
pon00982  Drug metabolism - cytochrome P450
pon01100  Metabolic pathways
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100939468 (AOX1)
   00350 Tyrosine metabolism
    100939468 (AOX1)
   00380 Tryptophan metabolism
    100939468 (AOX1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100939468 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    100939468 (AOX1)
   00830 Retinol metabolism
    100939468 (AOX1)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100939468 (AOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100939468 (AOX1)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100939468 (AOX1)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 100939468
NCBI-ProteinID: NP_001125740
Ensembl: ENSPPYG00000013058
UniProt: Q5RAF7
LinkDB
Position
2B
AA seq 1338 aa
MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITKRIRHHPANACLIPICSLYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTFCKTSGCCQSKENGVCC
LDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFSGER
MMWFSPVTLKELLEFKFKYPQAPVVMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHA
YNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHII
SRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSR
KWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPTTICAKNSCQKL
IGRCWNEEMLDTACRLVLDEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPV
HYPSLADKYESSLEDLHSKHHCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYC
DDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDIMTAEHLGDVNSFCFFTEAE
KFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSFFEPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKY
IQDIVASTLKLPANKVMCHVRRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGE
DMLITGGRHPYLGKYKAGFMDDGRILALDMEHYSNAGASLDESLFVIEMGLLKMDNAYKF
PNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKYPVGLGS
RAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETV
PNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKDWAQTAFDESISLSAVG
YFRGYESDMNWEKGEGHPFEYFVYGAACSEVEIDCLTGDHKNIGTDIVMDVGCSINPAID
VGQIGGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIVLLPPSQNSN
TLYSSKGLGESGVFLGCSVFFAIHDAVSAARQERGLHGPLSLNSPLTPEKIRMACEDKFT
KMIPRDEPGSYVPWNVPI
NT seq 4017 nt   +upstreamnt  +downstreamnt
atggaccgggcgtccgagctgctcttctacgtgaacggccgcaaggtgatagaaaaaaat
gtcgatcctgaaacaatgctgttgccttatttgaggaagaagcttcgactcacaggaact
aagtatggctgtggaggaggaggctgtggtgcttgtacagtgatgatatcacgatataac
cccatcaccaagaggataaggcatcacccagccaatgcctgtctgattcccatctgttct
ctgtatggtgctgccgtcaccacagtagaaggcataggaagcacccacaccagaattcat
cctgttcaggagaggatcgccaagtgtcacggcacccagtgtggcttctgcacacctggg
atggtgatgtccatctacacgctgctcaggaaccacccagagcccactctggatcagtta
actgatgcccttggtggtaacctgtgccgttgcactggatacaggcccataattgatgca
tgcaagactttctgtaaaacttcgggctgctgtcaaagtaaagaaaatggggtttgctgt
ttggatcaaggaatcaatggattgccagaatttgaggaaggaagtaagacaagtccaaaa
ctcttcgcagaagaggagtttctgccattggatccaacccaggaactgatatttcctcct
gagctaatgataatggctgagaaacagtcgcaaaggaccagagtgtttagcggtgagaga
atgatgtggttttcccccgtgaccctgaaggaactgctggaatttaaattcaagtatccc
caggcccctgttgtcatgggaaacacctctgtggggcctgaagtgaaatttaaaggcgtc
tttcacccagttataatttctcctgatagaattgaagaactgagtgttgtaaaccatgca
tataatggactcacccttggtgctggtctcagcctagcccaggtgaaggacattttggct
gatgtagtccagaagcttccagaggagaagacacagatgtaccatgctctcctgaagcat
ttgggaactctggctgggtcccagatcaggaacatggcttctttagggggacacatcatt
agcaggcatccagattcagatctgaatcccatcctggctgtgggtaactgtaccctcaac
ttgctatcaaaagaaggaaaacgacagattcctttaaatgagcaattcctcagcaagtgc
cctaatgcagatcttaagcctcaagaaatcttggtctcagtgaacatcccctactcaagg
aagtgggaatttgtgtcagccttccgacaagcccagcgacaggagaatgcgctagcgata
gtcaattcaggaatgagagtcttttttggagaaggggatggcattattagagagttatgc
atctcatatggaggcgttggtccaaccaccatctgtgccaagaattcctgccagaaactc
attggaaggtgctggaacgaagagatgctggatacagcctgcaggcttgttctggatgaa
gtctcccttttgggctcggcaccaggtgggaaggtggagttcaagaggactctcatcatc
agcttcctcttcaagttctacctggaagtgtcacagattttgaaaaagatggatccagtt
cactatcctagccttgcagacaaatatgaaagttctttagaagatcttcattccaaacat
cactgcagtacattaaagtaccagaatataggcccaaagcagcatcctgaagacccaatt
ggccaccccatcatgcatctctctggtgtgaagcatgccacgggggaggccatctactgt
gatgacatgcctctggtggaccaggaacttttcttgacttttgtgactagttcaagagct
catgctaagattgtgtctattgatctgtcagaagctctcagcatgcccggtgtggtggac
atcatgacagcagagcatcttggtgacgtcaactccttctgcttttttaccgaagctgag
aaatttctggcgacagataaggtgttctgtgtgggtcagcttgtctgtgccgtgcttgcc
gattctgaggttcaggcaaagcgagctgctaagcgagtgaagattgtctatcaagacttg
gagccgttgatactaacaatcgaggaaagtatacaacacaactccttcttcgagccagaa
aggaaactggaatatggaaatgttgacgaagcatttaaagtggttgatcaaattcttgaa
ggtgaaatacatatgggaggtcaagaacatttttatatggaaacccaaagcatgcttgtt
gttcccaagggagaggatcaagaaatggatgtctacgtgtccacacagtttcccaaatat
atacaggacattgttgcctcgaccttgaagctcccagctaacaaggtcatgtgccacgta
aggcgtgttggtggagcgtttggagggaaggtgttaaaaaccggaatcattgcagccgtc
actgcatttgccgcaaacaaacatggccgtgcagttcgctgtgttctggaacgaggagaa
gacatgttaataactggaggccgccatccttaccttggaaagtacaaagctggattcatg
gatgatggcagaatcttggccctggacatggagcattatagcaatgcaggtgcctccttg
gatgaatcattattcgtgatagaaatgggacttctgaaaatggacaatgcttacaagttt
cccaatctccgctgccggggttgggcatgcagaaccaaccttccatccaacacggctttt
cgtgggtttggctttcctcaggcagcgctgatcactgaatcttgtatcacagaggttgca
gccaaatgtggactatcccctgagaaggtgcgaatcataaacatgtacaaggaaattgat
caaacaccctacaaacaagagatcaatgccaagaacctgatccagtgttggagagaatgt
atggccatgtcttcctactccttgaggaaagttgctgtggaaaaattcaatgcagagaat
tattggaagaagaaaggactggccatggtccccctgaagtatcctgttggccttggctca
cgtgctgctggtcaggctgctgccttggttcacatttatcttgacggctctgtgctggtc
actcacggtggaattgaaatggggcagggggtccacactaaaatgattcaggtggtcagc
cgtgaattaagaatgccaatgtcgaatgtccacctgcgtggaacaagcacagaaaccgtc
cctaatgcaaatatctctggaggttctgtggtggcagatctcaacgggctggcagtaaag
gacgcctgtcaaactcttctaaaacgcctcgaacccatcatcagcaagaatcctaaagga
acttggaaagactgggcacagactgcttttgatgaaagcatcagcctttcagctgttgga
tacttcagaggttatgagtcagacatgaactgggagaaaggtgaaggccatcccttcgaa
tacttcgtttacggagctgcctgttctgaggttgaaatagactgcttgacgggggatcat
aagaacatcggaacagacattgtcatggatgttggctgcagtataaatccagccattgac
gtaggccagattggaggtgcatttattcaaggcatgggactttatacaatagaggaactg
aattattctccccagggcattctgcacactcgtggtccagaccaatataaaatccctgcc
atctgtgacatgcccacggagttgcacattgttttgttgcctccttctcaaaactcaaat
actctttattcatctaagggtctgggagagtcgggggtgttcctggggtgttccgtgttt
ttcgctatccatgacgcggtgagtgcagcacgacaggagagaggcctgcatggacccttg
agccttaatagtccactgaccccagagaagattaggatggcctgtgaagacaagttcaca
aaaatgattccgagagatgaacccggatcctatgttccttggaatgtacccatctga

DBGET integrated database retrieval system