KEGG   Pongo abelii (Sumatran orangutan): 100453730
Entry
100453730         CDS       T01416                                 

Gene name
RDX
Definition
(RefSeq) radixin isoform X2
  KO
K05762  radixin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04530  Tight junction
pon04810  Regulation of actin cytoskeleton
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100453730 (RDX)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100453730 (RDX)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100453730 (RDX)
   05205 Proteoglycans in cancer
    100453730 (RDX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100453730 (RDX)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100453730 (RDX)
SSDB
Motif
Pfam: ERM Mito_fiss_reg
Other DBs
NCBI-GeneID: 100453730
NCBI-ProteinID: XP_009245307
Ensembl: ENSPPYG00000003852
UniProt: A0A2J8X257
LinkDB
Position
11
AA seq 257 aa
MERLKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQA
ADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVM
SAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQ
LQALSSELAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAMWGPK
LYALFQMRSCQSSIKQM
NT seq 774 nt   +upstreamnt  +downstreamnt
atggaacgtctaaaacaaattgaagagcagacaattaaagcccagaaagaactagaagaa
cagactcgaaaagctctagaactggatcaggaacgaaaacgagcaaaagaagaagcagaa
cggcttgaaaaggagcgtcgagctgctgaagaggcgaagtctgccatagcaaaacaagct
gccgaccagatgaagaatcaggagcagctagcagcagaacttgctgaattcactgccaag
attgcacttctagaagaagccaagaagaaaaaggaagaggaagctactgagtggcaacac
aaagcttttgcagcccaggaagacttggaaaagaccaaagaagagttaaaaactgtgatg
tctgccccccctccacctccaccaccaccagtcattcctccaacagaaaatgaacatgat
gaacacgatgagaataatgctgaagctagtgctgaattatcaaatgaaggggtaatgaac
catagaagcgaggaagaacgtgtaaccgaaacacagaaaaatgagcgtgttaagaagcaa
cttcaggcattaagttcagaattagcccaagccagagatgaaaccaagaaaacacaaaat
gatgttcttcatgctgagaatgttaaagcaggccgtgataagtacaagactctgcgacag
attcgacaaggcaatacaaagcagcgtatcgatgagtttgaagcaatgtggggacccaaa
ctgtatgcattgttccagatgcgctcttgccaaagcagcataaagcaaatgtaa

DBGET integrated database retrieval system