KEGG   Pongo abelii (Sumatran orangutan): 100454731
Entry
100454731         CDS       T01416                                 

Gene name
FLT3
Definition
(RefSeq) receptor-type tyrosine-protein kinase FLT3 isoform X1
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05221  Acute myeloid leukemia
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100454731 (FLT3)
   04014 Ras signaling pathway
    100454731 (FLT3)
   04151 PI3K-Akt signaling pathway
    100454731 (FLT3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100454731 (FLT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454731 (FLT3)
   05202 Transcriptional misregulation in cancer
    100454731 (FLT3)
   05230 Central carbon metabolism in cancer
    100454731 (FLT3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100454731 (FLT3)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100454731 (FLT3)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100454731 (FLT3)
CD molecules [BR:pon04090]
 Proteins
  100454731 (FLT3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig I-set Ig_3 Ig_2 APH
Other DBs
NCBI-GeneID: 100454731
NCBI-ProteinID: XP_024086677
Ensembl: ENSPPYG00000005244
LinkDB
Position
13
AA seq 993 aa
MPALARGGGRLPLLVVLSAIIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSAGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDDGYSISKFCNHKHQPGEYIFHA
ENDDAQLTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITQ
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIDYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQACWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
RVSERPHTYQNRRPFSREMDSGPLSPQTQVEDS
NT seq 2982 nt   +upstreamnt  +downstreamnt
atgccggcgttggcgcgcggcggcggccggctgccgctgctcgttgttttgtctgcaatc
atatttgggactattacaaatcaagatctgcctgtgatcaagtgtgttttaatcaatcat
aagaacaatgattcatcagtggggaagtcatcatcatatcccatggtgtcagaatcccca
gaagacctcgggtgtgcattgagaccccagagcgcagggacagtgtacgaagctgccgct
gtggaagtggatgtatctgcttccatcacattgcaagtgctggttgacgccccagggaac
atttcctgtctctgggtctttaagcacagctccctgaattgccagccacattttgattta
caaaacagaggagttgtttccatggtcattttgaaaatgacagaaacccaagctggagaa
tacctactttttattcagagtgaagctaccaattacacaatattgtttacagtgagtata
agaaataccctgctttacacattaagaagaccttactttagaaaaatggaaaaccaggac
gccctggtctgcatatctgagagcgttccagagccgatcgtggaatgggtgctttgcgat
tcacagggggaaagctgtaaagaagaaagtccagctgttgttaaaaaggaggaaaaagtg
cttcatgaattatttgggacggacataaggtgctgtgccagaaatgaactgggcagggaa
tgcaccaggctcttcacaatagatctaaatcaaactcctcagaccacattgccacaatta
tttcttaaagtaggggaacccttatggataaggtgcaaagctgttcatgtgaaccatgga
ttcgggctcacctgggaattagaaaacaaagcactcgaggagggcaactactttgagatg
agtacctattcaacaaacagaactatgatacggattctgtttgcttttgtatcatcagtg
gcaagaaacgacaccggatactacacttgttcctcttcaaagcatcccagtcaatcagct
ttggttaccatcgtagaaaagggatttataaatgctaccaattcaagtgaagattatgaa
attgaccaatatgaagagttttgtttttctgtcaggtttaaagcctacccacaaatcaga
tgtacgtggaccttctctcgaaaatcatttccttgtgagcaaaagggtctcgatgacgga
tacagcatatccaagttttgcaatcataagcaccagccaggagaatatatattccatgca
gaaaatgatgatgcccaattgaccaaaatgttcacgctgaatataagaaggaaacctcaa
gtgctcgcagaagcatcagcaagtcaggcgtcctgtttctcggatggatacccattacca
tcttggacctggaagaagtgttcagacaagtctcccaactgcacagaagagatcacacaa
ggagtctggaatagaaaggctaacagaaaagtatttggacagtgggtgtcgagcagtact
ctaaacatgagtgaagccataaaagggttcctggtcaagtgctgtgcatacaattccctt
ggcacatcttgtgagacgatccttttaaactctccaggccccttccctttcatccaagac
aacatctcattctatgcaacaattggtgtttgtctcctcttcattgtcgttttaaccctg
ctaatttgtcacaagtacaaaaagcaatttaggtatgaaagccagctacagatggtacag
gtgaccggctcctcagataatgagtacttctacgttgatttcagagaatatgaatatgat
ctcaaatgggagtttccaagagaaaatttagagtttgggaaggtactaggatcaggtgct
tttggaaaagtgatgaacgcaacagcttatggaattagcaaaacaggagtctcaatccag
gttgccgtcaaaatgctgaaagaaaaagcagacagctctgaaagagaggcactcatgtca
gaactcaagatgatgacccagctgggaagccacgagaatattgtgaatctgctgggggcg
tgcacactgtcaggaccaatttacttgatttttgaatactgttgctatggtgatcttctc
aactatctaagaagtaaaagagaaaaatttcacaggacttggacagagattttcaaggaa
cacaatttcagtttttaccccactttccaatcacatccaaattccagcatgcctggttca
agagaagttcagatacacccggactcggatcaaatctcagggcttcatgggaattcattt
cactctgaagatgaaattgattatgaaaaccaaaaaaggctggaagaagaggaagacttg
aatgtgcttacatttgaagatcttctttgctttgcatatcaagttgccaaaggaatggaa
tttctggaatttaagtcgtgtgttcacagagacctggccgccaggaacgtgctcgtcacc
cacgggaaggtggtgaagatatgtgactttggattggctcgagatatcatgagtgattcc
aactatgttgtcaggggcaatgcccgtctgcctgtaaaatggatggcccctgaaagcctg
tttgaaggcatctacaccattaagagtgatgtctggtcatacggaatattactgtgggaa
atattctcacttggtgtgaatccttaccctggcattccggttgatgctaacttctacaaa
ctgattcaaaatggatttaaaatggatcagccattttatgctacagaagaaatatacatt
ataatgcaagcctgctgggcttttgactcaaggaaacggccatccttccctaatttgact
tcatttttaggatgtcagctggcagatgcagaagaagcgatgtatcagaatgtggatggt
cgtgtttcggaacgtcctcacacctaccaaaacaggcgacctttcagcagagagatggat
tcggggccactctctccgcagactcaggtcgaagattcctag

DBGET integrated database retrieval system