KEGG   Pongo abelii (Sumatran orangutan): 100455766
Entry
100455766         CDS       T01416                                 

Gene name
RAPGEF5
Definition
(RefSeq) rap guanine nucleotide exchange factor 5
  KO
K08019  Rap guanine nucleotide exchange factor 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100455766 (RAPGEF5)
   04015 Rap1 signaling pathway
    100455766 (RAPGEF5)
SSDB
Motif
Pfam: RasGEF RasGEF_N DEP RA
Other DBs
NCBI-GeneID: 100455766
NCBI-ProteinID: XP_024106097
LinkDB
Position
7
AA seq 730 aa
MAIGVWQLLLDMGIMLSVDQHLYFQDTYVFYQFSSDECSYLYCEFEREEEWQNGVKLLLQ
LVPLIPARGGICELSHQKIEDSEESSDEILVRLTSAVQRELAAVIALKARKSAIEQDEEN
NDKHVAVTEAESVPDSQAGVMCKLQERDEIGRIELVQKLAKENYQFLQTDKKEQEKSEHQ
DDEVTTVQVKEQDQSVLVLKKVQCCGPAPTAGSAESHWRYVVVSGTPEKILEHLLNDLHL
EEVQDKETETLLDDFLLTYTVFMTTDDLCQALLRHYSAKKYQGKEENSDVPRRKRKVLHL
VSQWIALYKDWLHEDEHSKMFLKTIYRNVLDDVYEYPILEKELKEFQKILGMHRRHTVDE
YSPQKKNKALFHQFSLKENWLPHRGTVTETEEIFCHVYITEHSYVSVKAKVSSIAQEILK
VVAEKIQYAEEDLALVAITFSGEKHELQPNDLVISKSLEASGRIYVYRKDLADTLNPFAE
NEESQQRSMRILGMNTWDLALELMNFDWSLFNSIHEQELIYFTFSRQGSGEHTANLSLLL
QRCNEVQLWVATEILLCSQLGKRVQLVKKFIKIAAHCKAQRNLNSFFAIVMGLNTASVSR
LSQTWEKIPGKFKKLFSELESLTDPSLNHKAYRDAFKKMKPPKIPFMPLLLKDVTFIHEG
NKTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGDLSPKEHQELKSYVNHLYVIDSQQALF
ELSHRIEPRV
NT seq 2193 nt   +upstreamnt  +downstreamnt
atggccataggagtctggcaactcctactggacatgggaattatgttatcagtggaccag
catctatactttcaagatacttatgttttctaccagttttcctctgatgaatgtagctac
ttgtactgtgaatttgaaagagaagaagaatggcaaaatggtgtcaagcttttactgcaa
cttgtgcctctcattcctgctagaggtggcatctgtgaactgtctcatcagaaaattgaa
gactccgaagaaagcagtgatgaaattctcgtgcgtctaacatctgcggtgcagagagag
ctagcagctgttattgctttgaaagcaaggaagtctgcaattgaacaagatgaagaaaac
aatgacaaacatgtagctgtaacagaagccgaaagtgttccagattctcaggcaggggtg
atgtgcaagcttcaggaaagagatgaaatcggacgaattgaactagtccagaagctggca
aaagaaaactatcagtttttgcagacggacaaaaaagaacaggagaagtctgaacaccaa
gatgatgaagtgacgactgttcaggttaaagagcaagaccagagtgtcctggtgctgaag
aaagtgcagtgctgtggcccagcccccacagctgggagtgcggagagccattggagatat
gtggtggtgtccgggaccccggagaaaattttggagcaccttttgaatgacttgcacctg
gaagaagtccaggacaaagaaacagagaccctcctggatgacttccttctcacgtacact
gtcttcatgacaactgatgacttgtgccaggctctgttaaggcactattctgctaagaag
tatcaaggcaaagaggaaaactcagatgttcctcgtaggaaacgtaaagtcttgcatctt
gtttcccagtggattgctctgtacaaagattggttacatgaagatgaacattcaaaaatg
tttttaaagaccatatataggaatgtactggatgatgtttatgaatatccaatacttgaa
aaagaattgaaagaatttcaaaagatacttggaatgcaccgtcgtcacactgtagatgaa
tattcaccacaaaaaaagaataaagcccttttccaccaattcagtcttaaggagaactgg
ctcccgcatagagggactgtgactgaaacggaggaaattttctgccatgtgtatataaca
gagcactcctatgtcagtgtgaaggcaaaagtttccagtatagcccaagagatcctaaaa
gtcgtggcagaaaagatccagtatgcagaagaggatctggctctggtggccatcacattc
tctggggaaaagcatgaacttcagccgaatgacttagtcatctccaaatccctcgaggca
tctggtcgaatatatgtctaccggaaagacctggcggacactttgaacccatttgcagaa
aatgaggaatcacagcaaaggtcgatgaggattttgggaatgaacacttgggatcttgct
ctggaattaatgaattttgattggagtctattcaattcaattcacgagcaagagctgatc
tacttcacattcagcagacagggaagtggggaacacactgcaaacctcagccttctactc
cagagatgcaatgaggtccagctttgggtggccacggagattctgctctgcagccagctg
ggcaagcgagtgcagctggtgaaaaaattcatcaaaattgcggctcactgcaaagcccag
agaaacctgaattctttctttgccattgtgatgggtctcaacactgcttctgtcagtcga
ctgtcgcagacctgggagaaaatccctgggaagtttaagaaacttttctctgaacttgaa
agtttaacagatccttccctaaatcacaaagcctacagagatgcattcaaaaagatgaag
ccaccaaaaatccctttcatgcccttattgcttaaagatgtaacatttattcatgaagga
aataaaacttttttggataatcttgtcaattttgaaaagctgcatatgatcgcagacact
gtccgaaccctgagacactgcaggactaaccagtttggtgacctgtctccaaaagagcat
caagagttaaagtcctatgttaatcacctgtatgtcattgacagccagcaggctctgttt
gagctctcacacaggatcgagcctcgggtgtga

DBGET integrated database retrieval system