Pongo abelii (Sumatran orangutan): 100456049 Help Entry 100456049         CDS       T01416                                  Gene name RELA Definition (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon01523   Antifolate resistance pon04010   MAPK signaling pathway pon04014   Ras signaling pathway pon04024   cAMP signaling pathway pon04062   Chemokine signaling pathway pon04064   NF-kappa B signaling pathway pon04066   HIF-1 signaling pathway pon04071   Sphingolipid signaling pathway pon04137   Mitophagy - animal pon04151   PI3K-Akt signaling pathway pon04210   Apoptosis pon04211   Longevity regulating pathway pon04218   Cellular senescence pon04380   Osteoclast differentiation pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04625   C-type lectin receptor signaling pathway pon04657   IL-17 signaling pathway pon04658   Th1 and Th2 cell differentiation pon04659   Th17 cell differentiation pon04660   T cell receptor signaling pathway pon04662   B cell receptor signaling pathway pon04668   TNF signaling pathway pon04722   Neurotrophin signaling pathway pon04917   Prolactin signaling pathway pon04920   Adipocytokine signaling pathway pon04926   Relaxin signaling pathway pon04931   Insulin resistance pon04932   Non-alcoholic fatty liver disease pon04933   AGE-RAGE signaling pathway in diabetic complications pon05010   Alzheimer disease pon05022   Pathways of neurodegeneration - multiple diseases pon05030   Cocaine addiction pon05132   Salmonella infection pon05133   Pertussis pon05134   Legionellosis pon05135   Yersinia infection pon05140   Leishmaniasis pon05142   Chagas disease pon05145   Toxoplasmosis pon05146   Amoebiasis pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05166   Human T-cell leukemia virus 1 infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05200   Pathways in cancer pon05202   Transcriptional misregulation in cancer pon05203   Viral carcinogenesis pon05212   Pancreatic cancer pon05215   Prostate cancer pon05220   Chronic myeloid leukemia pon05221   Acute myeloid leukemia pon05222   Small cell lung cancer pon05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pon05321   Inflammatory bowel disease pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100456049 (RELA)    04014 Ras signaling pathway     100456049 (RELA)    04064 NF-kappa B signaling pathway     100456049 (RELA)    04668 TNF signaling pathway     100456049 (RELA)    04066 HIF-1 signaling pathway     100456049 (RELA)    04071 Sphingolipid signaling pathway     100456049 (RELA)    04024 cAMP signaling pathway     100456049 (RELA)    04151 PI3K-Akt signaling pathway     100456049 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100456049 (RELA)   09143 Cell growth and death    04210 Apoptosis     100456049 (RELA)    04218 Cellular senescence     100456049 (RELA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100456049 (RELA)    04621 NOD-like receptor signaling pathway     100456049 (RELA)    04622 RIG-I-like receptor signaling pathway     100456049 (RELA)    04623 Cytosolic DNA-sensing pathway     100456049 (RELA)    04625 C-type lectin receptor signaling pathway     100456049 (RELA)    04660 T cell receptor signaling pathway     100456049 (RELA)    04658 Th1 and Th2 cell differentiation     100456049 (RELA)    04659 Th17 cell differentiation     100456049 (RELA)    04657 IL-17 signaling pathway     100456049 (RELA)    04662 B cell receptor signaling pathway     100456049 (RELA)    04062 Chemokine signaling pathway     100456049 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100456049 (RELA)    04917 Prolactin signaling pathway     100456049 (RELA)    04926 Relaxin signaling pathway     100456049 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100456049 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     100456049 (RELA)   09149 Aging    04211 Longevity regulating pathway     100456049 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100456049 (RELA)    05202 Transcriptional misregulation in cancer     100456049 (RELA)    05203 Viral carcinogenesis     100456049 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100456049 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     100456049 (RELA)    05221 Acute myeloid leukemia     100456049 (RELA)    05220 Chronic myeloid leukemia     100456049 (RELA)    05215 Prostate cancer     100456049 (RELA)    05222 Small cell lung cancer     100456049 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     100456049 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     100456049 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     100456049 (RELA)   09165 Substance dependence    05030 Cocaine addiction     100456049 (RELA)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100456049 (RELA)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100456049 (RELA)    04931 Insulin resistance     100456049 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     100456049 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     100456049 (RELA)    05135 Yersinia infection     100456049 (RELA)    05133 Pertussis     100456049 (RELA)    05134 Legionellosis     100456049 (RELA)    05152 Tuberculosis     100456049 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100456049 (RELA)    05170 Human immunodeficiency virus 1 infection     100456049 (RELA)    05162 Measles     100456049 (RELA)    05164 Influenza A     100456049 (RELA)    05161 Hepatitis B     100456049 (RELA)    05160 Hepatitis C     100456049 (RELA)    05168 Herpes simplex virus 1 infection     100456049 (RELA)    05163 Human cytomegalovirus infection     100456049 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     100456049 (RELA)    05169 Epstein-Barr virus infection     100456049 (RELA)    05165 Human papillomavirus infection     100456049 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     100456049 (RELA)    05145 Toxoplasmosis     100456049 (RELA)    05140 Leishmaniasis     100456049 (RELA)    05142 Chagas disease     100456049 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100456049 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pon03000]     100456049 (RELA) Transcription factors [BR:pon03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     100456049 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  100456049 NCBI-ProteinID:  XP_002821553 Ensembl:  ENSPPYG00000003053 UniProt:  A0A6D2YCQ1 A0A2J8TZI4 LinkDB All DBs Position 11 AA seq 551 aa AA seqDB search MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAINQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY DEFPTMVFPSGQISQASALAPAPPQVLPQASAPAPAPAMVSALAQAPAPVPVLPPGPPQA VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM DFSALLSQISS NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccctat gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg cgctccgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc atcaagatcaatggctacacaggaccagggacagtacgcatctccctggtcaccaaggac cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt gtgaagaagcgggacctggagcaggctatcaatcagcgcatccagaccaacaacaacccc ttccaagttcctatagaagagcagcgtggggactatgacctgaatgctgtgcggctctgc ttccaggtgacagtgcgggatccatcaggcaggcccctccgcctgccgcctgtcctttct catcccatctttgacaatcgtgcccccaacactgccgagctcaagatctgccgagtgaac cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttcg caagctgatgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc agcctgcaggctcctgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag aaacgcaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga cccaccgacccccggcctccacctcgacgcattgctgtgccttcccgcagctcagcttct gtccccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactat gatgagtttcccaccatggtgtttccttctgggcagataagccaggcctcagccttggcc ccggcccctccccaagtcctgccccaggcttcagcccctgcccctgctccagccatggta tcagctctggcccaggccccagcccctgtcccagtcctacccccaggccctcctcaggct gtggccccacctgcccccaagcccacccaggctggggaaggaacgctgtcagaggccctg ctgcagctgcagtttgatgatgaagacctgggggccttgcttggcaacagcacagaccca gccgtgttcacagacctggcatccgtcgacaactccgagtttcagcagctgctgaaccag ggcatacctgtggccccccacacaactgagcccatgctgatggagtaccctgaggctata actcgcctagtgacaggggcccagaggccccccgacccagctcctgctccactgggggcc ccagggctccccaacggcctcctttcaggagatgaagacttctcttccattgcggacatg gacttctcagccctgctgagtcagatcagctcctaa

DBGET integrated database retrieval system