KEGG   Pongo abelii (Sumatran orangutan): 100456464
Entry
100456464         CDS       T01416                                 

Gene name
TLR2
Definition
(RefSeq) toll-like receptor 2 isoform X1
  KO
K10159  toll-like receptor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon05132  Salmonella infection
pon05134  Legionellosis
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05144  Malaria
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05162  Measles
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05205  Proteoglycans in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05321  Inflammatory bowel disease
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100456464 (TLR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100456464 (TLR2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100456464 (TLR2)
   04620 Toll-like receptor signaling pathway
    100456464 (TLR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100456464 (TLR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100456464 (TLR2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100456464 (TLR2)
   05321 Inflammatory bowel disease
    100456464 (TLR2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100456464 (TLR2)
   05134 Legionellosis
    100456464 (TLR2)
   05152 Tuberculosis
    100456464 (TLR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100456464 (TLR2)
   05161 Hepatitis B
    100456464 (TLR2)
   05171 Coronavirus disease - COVID-19
    100456464 (TLR2)
   05162 Measles
    100456464 (TLR2)
   05168 Herpes simplex virus 1 infection
    100456464 (TLR2)
   05169 Epstein-Barr virus infection
    100456464 (TLR2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100456464 (TLR2)
   05144 Malaria
    100456464 (TLR2)
   05145 Toxoplasmosis
    100456464 (TLR2)
   05140 Leishmaniasis
    100456464 (TLR2)
   05142 Chagas disease
    100456464 (TLR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100456464 (TLR2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100456464 (TLR2)
   04054 Pattern recognition receptors [BR:pon04054]
    100456464 (TLR2)
   04090 CD molecules [BR:pon04090]
    100456464 (TLR2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100456464 (TLR2)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    100456464 (TLR2)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100456464 (TLR2)
Pattern recognition receptors [BR:pon04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100456464 (TLR2)
CD molecules [BR:pon04090]
 Proteins
  100456464 (TLR2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Hyaluronan
  Cell surface receptors
   100456464 (TLR2)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 LRR_1 LRR_5 LRRCT
Other DBs
NCBI-GeneID: 100456464
NCBI-ProteinID: XP_024102319
Ensembl: ENSPPYG00000015131
LinkDB
Position
4
AA seq 783 aa
MPHTLWMVWVLGVIISLSKEESSSQALSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSN
NRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFK
TLSSLTFLNLLGNPYKTLGETSLFSHLTKLRMLRVGNMDTFTKIQRKDFAGLTFLEELEI
DASDLQSYEPKSLKSIQNVSHLILHMKQHTLLLEIFVDVTSSVECLELQDTDLDTFHFSE
LSTGETNSLIKKFTFRNVKITDEGLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDND
RVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCSLSRHLKS
LEYLDLSENLMVEEYLKNSACEDAWPSLRTLILRQNHLASLEKTGETLLTLKNLTNLDIS
KNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLKE
LYISRNKLMTLPDASLLPMLLVLKISRNTITTFSKEQLDSFHTLKTLEAGGNNFICSCEF
LSFTQEQQALAKVLIDWPANYLCDSPSHVHGQRVQDVRLSVSECHRTALVSGMCCALFLL
ILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRDICYDAFVSYSERDAYWVENLMVQ
ELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSH
FRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAA
IKS
NT seq 2352 nt   +upstreamnt  +downstreamnt
atgccacatactttgtggatggtgtgggtcttgggggtcatcatcagcctctccaaggaa
gaatcctccagtcaggctctgtcttgtgaccgcaatggtatctgcaagggcagctcagga
tctttaaactccattccctcagggctcacagaagctgtaaaaagccttgacctgtccaac
aacaggatcacctacattagcaacagtgacctacagaggtgtgtgaacctccaggctctg
gtgctgacatccaatggaattaacacaatagaggaagattctttttcttccctgggcagt
cttgaacatttagacttatcctataattacttatctaatttatcgtcttcctggttcaag
accctttcttctttgacattcttaaacttactgggaaatccttacaaaaccctaggggaa
acatctcttttttctcatctcacaaaattgcgaatgctgagagtaggaaatatggacacc
ttcactaagattcaaagaaaagattttgctggacttaccttccttgaggaacttgagatt
gatgcttcagatctacagagctatgagccaaaaagtttgaagtcaattcagaacgtaagt
catctgatccttcatatgaagcagcatactttactgctggagatttttgtagatgttaca
agttccgtggaatgtttggaactgcaagatactgatttggacactttccatttttcagaa
ctatccactggtgaaacaaattcattgattaaaaagtttacatttagaaatgtgaaaatc
accgatgaaggtttgtttcaggtcatgaaacttttgaatcagatttctggattgttagaa
ttagagtttgatgactgtacccttaatggagttggtaattttagagcatctgataatgac
agagttatagatccaggtaaagtggaaacgttaacaattcggaggctgcatattccaagg
ttttacttattttatgatctgagcactttatattcactcacagaaagagttaaaagaatc
acagtagaaaacagtaaagtttttctggttccttgttcactttcacgacatttaaaatca
ttagaatacttggatctcagtgaaaatttgatggttgaagaatacttgaaaaattcagcc
tgtgaggatgcctggccctctctacgaactttaattttaaggcaaaatcatttggcatca
ttggaaaaaaccggagagactttgcttactctgaaaaacttgactaaccttgatatcagt
aagaatagttttcattctatgcctgaaacttgtcagtggccagaaaagatgaaatatttg
aacttatccagcacacgaatacacagtgtaacaggctgcattcccaagacactggaaatt
ttagatgttagcaacaacaatctcaatttattttctttgaatttgccgcaactcaaagaa
ctttatatttccagaaataagttgatgactctaccagatgcctccctcttacccatgtta
ctagtattgaaaatcagtaggaatacaataactactttttctaaggagcaacttgactca
tttcacacactgaagactttggaagctggtggcaataacttcatttgctcctgtgaattc
ctctccttcactcaggagcagcaagcactggccaaagtcctgattgattggccagcaaat
tacctgtgtgactctccatcccatgtgcatggccagcgggttcaggacgtccgcctctcg
gtgtcggaatgtcacaggacagcactggtgtctggcatgtgctgtgctctgttcctgctg
atcctgctcacgggggtcctgtgccaccgtttccatggcctgtggtacatgaaaatgatg
tgggcctggctccaggccaaaaggaagcccaggaaagctcccagcagggacatctgctat
gatgcatttgtttcttacagtgagcgtgatgcctactgggtggagaaccttatggtccag
gagctggagaacttcaatccccccttcaagttgtgtcttcataagcgggacttcattcct
ggcaagtggatcattgacaatatcattgactccattgaaaagagccacaaaactgtcttt
gtgctttctgaaaactttgtgaagagtgaatggtgcaagtatgaactggacttctcccat
ttccgtctttttgatgagaacaatgatgctgccattctcattcttctggagcccattgag
aaaaaagccattccccagcgcttctgcaagctgcggaagataatgaacaccaagacctac
ctggagtggcccatggatgaggctcagcgggaagggttttgggtaaatctgagagctgcg
ataaagtcctag

KEGG   Pongo abelii (Sumatran orangutan): 100457237
Entry
100457237         CDS       T01416                                 

Gene name
TLR4
Definition
(RefSeq) toll-like receptor 4 isoform X1
  KO
K10160  toll-like receptor 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04064  NF-kappa B signaling pathway
pon04066  HIF-1 signaling pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon05132  Salmonella infection
pon05133  Pertussis
pon05134  Legionellosis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05144  Malaria
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05162  Measles
pon05164  Influenza A
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05205  Proteoglycans in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05321  Inflammatory bowel disease
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100457237 (TLR4)
   04066 HIF-1 signaling pathway
    100457237 (TLR4)
   04151 PI3K-Akt signaling pathway
    100457237 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100457237 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    100457237 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100457237 (TLR4)
   04620 Toll-like receptor signaling pathway
    100457237 (TLR4)
   04621 NOD-like receptor signaling pathway
    100457237 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100457237 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100457237 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100457237 (TLR4)
   05321 Inflammatory bowel disease
    100457237 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100457237 (TLR4)
   05135 Yersinia infection
    100457237 (TLR4)
   05133 Pertussis
    100457237 (TLR4)
   05134 Legionellosis
    100457237 (TLR4)
   05152 Tuberculosis
    100457237 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100457237 (TLR4)
   05161 Hepatitis B
    100457237 (TLR4)
   05171 Coronavirus disease - COVID-19
    100457237 (TLR4)
   05164 Influenza A
    100457237 (TLR4)
   05162 Measles
    100457237 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100457237 (TLR4)
   05144 Malaria
    100457237 (TLR4)
   05145 Toxoplasmosis
    100457237 (TLR4)
   05140 Leishmaniasis
    100457237 (TLR4)
   05142 Chagas disease
    100457237 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100457237 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:pon04054]
    100457237 (TLR4)
   04090 CD molecules [BR:pon04090]
    100457237 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100457237 (TLR4)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    100457237 (TLR4)
Pattern recognition receptors [BR:pon04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100457237 (TLR4)
CD molecules [BR:pon04090]
 Proteins
  100457237 (TLR4)
Glycosaminoglycan binding proteins [BR:pon00536]
 Hyaluronan
  Cell surface receptors
   100457237 (TLR4)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 LRR_1 LRR_6 DUF1863
Other DBs
NCBI-GeneID: 100457237
NCBI-ProteinID: XP_024108556
Ensembl: ENSPPYG00000019548
LinkDB
Position
9
AA seq 830 aa
MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD
LSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQNLALG
AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHL
DLSSNKIQSIYCKDLQVLHQMPLLNLSLDLSLNAMNFIQPGAFKEIRLHKLTLRNSFDSL
NVMKTCIQGLAGLEVHHLVLGEFRNEKNLEKFDTSALEGLCNLTIEEFRLAYLDYYLDDI
IDLFNCLANVSSFSLVSVTIKSVKDFSYNFGWQHLELVNCKFGQFPTLELKSLKRLTFTA
NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNDVITMGSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLKVLKMAG
NSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPY
KCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
LVEVERMECATPSDKQGMPVLSLNITCQMNKTVIGVSVFSVLVVSVVAVLVYKFYFHLML
LAGCIKYGRGENTYDAFVIYSSQDEDWVRNELVKNLEEGVPTFQLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTG
NT seq 2493 nt   +upstreamnt  +downstreamnt
atgatgtctgcctcgcgcctggctgggactctgatcccagccatggccttcctctcctgc
gtgagaccggaaagctgggagccctgcgtagaggtggttcctaacattacttatcaatgc
atggagctgaatttctacaaaatccccgacaacctccccttctcaaccaagaacctggac
ctgagctttaatcccctgaggcatttaggcagctatagcttcttcagtttcccagaactg
caggtgctggatttatccaggtgtgaaatccagacaattgaagatggggcatatcagagc
ctaagccacctctccaccttaatattgacaggaaaccccatccagaatttagccctggga
gccttttctggactgtcaagtttacagaagctggtggctgtggagacaaatctggcatct
ctagagaacttccccattggacatctcaaaactttgaaagaacttaatgtggctcacaat
cttatccagtctttcaaattacctgagtatttttccaatctgaccaatctagagcacttg
gacctttccagcaacaagattcaaagtatttattgcaaagacttgcaggttctacatcaa
atgccgctactcaatctctctttagacctgtccctgaacgctatgaactttatccaacca
ggtgcatttaaagaaattaggcttcataagctgactttgagaaatagttttgatagttta
aatgtaatgaaaacttgtattcaaggtctggctggtttagaagtccatcatttggttctg
ggagaatttagaaatgaaaaaaacttggaaaagtttgacacatctgctctagagggcctg
tgcaatttgaccattgaagaattccgattagcatacttagactactacctcgatgatatt
attgacttatttaattgtttggcaaatgtttcttcattttccctggtgagtgtgactatt
aaaagtgtaaaagacttttcttataatttcggatggcaacatttagaattagttaactgt
aaatttggacagtttcccacattggaactcaaatctctcaaaaggcttactttcactgcc
aacaaaggtgggaatgctttttcagaagttgatctaccaagccttgagtttctagatctc
agtagaaatggcttgagtttcaaaggttgctgttctcaaagtgattttgggacaaccagc
ctaaagtatttagatctgagcttcaatgatgttattaccatgggttcaaacttcttgggc
ttagaacaactagaacatctggatttccagcattccaatttgaaacaaatgagtgagttt
tcagtattcctatcactcagaaacctcatttaccttgacatttctcatactcacaccaga
gttgctttcaatggcatcttcaatggcttgtccagtctcaaagtcttgaaaatggctggc
aattctttccaggaaaacttccttccagatatcttcacagagctgagaaacttgaccttc
ctggacctctctcagtgtcaactggagcagttgtctccaacagcatttaactcactctct
agtcttcaggtactaaatatgagccacaacaacttcttttcattggatacgtttccttat
aagtgtctgaactccctccaggttcttgattacagtctcaatcacataatgacttccaaa
aaacaggaactacagcattttccaagtagtctagctttcttaaatcttactcagaatgac
tttgcttgtacttgtgaacaccagagtttcctgcagtggatcaaggaccagaggcagctc
ttggtggaagttgaacgaatggaatgtgcaacaccttcagataagcagggcatgcctgtg
ctgagtttgaatatcacctgtcagatgaataagaccgtcattggtgtgtcagtcttcagt
gtgcttgtagtatctgttgtagcagttctggtctataagttctattttcacctgatgctt
cttgctggctgtataaagtatggtagaggtgaaaacacgtatgatgcctttgttatctac
tcaagccaggatgaggactgggtaaggaatgagctagtaaagaatttagaagaaggggta
cctacctttcagctctgccttcactacagagactttattcccggtgtggccattgctgcc
aacatcatccatgaaggtttccataaaagccgaaaggtgattgttgtggtgtcccagcac
ttcatccagagccgctggtgtatctttgaatatgagattgctcagacctggcagtttctg
agcagtcgtgctggtatcatcttcattgtcctgcagaaggtggagaagaccctgctcagg
cagcaggtggaactgtaccgccttctcagcaggaacacttacctggagtgggaggacagt
gtcctggggcggcacatcttctggagacgactcagaaaagccctgctggatggtaaatca
tggaatccagaaggaacagtgggtacaggataa

DBGET integrated database retrieval system