KEGG   Pongo abelii (Sumatran orangutan): 100457558
Entry
100457558         CDS       T01416                                 

Gene name
CD38
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00760  Nicotinate and nicotinamide metabolism
pon01100  Metabolic pathways
pon04020  Calcium signaling pathway
pon04640  Hematopoietic cell lineage
pon04921  Oxytocin signaling pathway
pon04970  Salivary secretion
pon04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100457558 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100457558 (CD38)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100457558 (CD38)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100457558 (CD38)
  09154 Digestive system
   04970 Salivary secretion
    100457558 (CD38)
   04972 Pancreatic secretion
    100457558 (CD38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100457558 (CD38)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100457558 (CD38)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     100457558 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     100457558 (CD38)
CD molecules [BR:pon04090]
 Proteins
  100457558 (CD38)
Glycosaminoglycan binding proteins [BR:pon00536]
 Hyaluronan
  Cell surface receptors
   100457558 (CD38)
SSDB
Motif
Pfam: Rib_hydrolayse
Other DBs
NCBI-GeneID: 100457558
NCBI-ProteinID: XP_002814660
Ensembl: ENSPPYG00000014618
UniProt: A0A6D2Y6G1 H2PCY7
LinkDB
Position
4
AA seq 300 aa
MANCEFSPVSGDKPCCRLSRRAQLCLGVCILVLIVVVVVAVVVPRWRQQWSGPGTTKRFP
ETVLERCVKYTEIYPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN
KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSEINYQSCPDWRKDC
SNNPVSVFWKTVSHRFAEAACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA
WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKSPEDSSCISEI
NT seq 903 nt   +upstreamnt  +downstreamnt
atggccaactgcgagttcagcccggtgtccggggacaaaccctgctgccggctctctagg
agagcccaactctgtcttggcgtctgtatcctggtcctgatcgtcgtcgtggtggtcgcg
gtagtcgtcccgaggtggcgccagcagtggagcggtccgggcaccaccaagcgctttccc
gagaccgtcctggagcgatgcgtcaagtacactgaaatctatcctgagatgagacatgta
gactgccaaagtgtatgggatgcattcaagggtgcatttatttcaaaacatccttgcaac
attactgaagaagactatcagccactaatgaagttgggaactcagaccgtaccttgcaac
aagattcttctttggagcagaataaaagatctggcccatcagttcacacaggtccagcgg
gacatgttcaccctggaggacacgctgctaggctaccttgctgatgacctcacatggtgt
ggtgaattcaacacttccgaaataaactatcaatcttgcccagactggagaaaggactgc
agcaacaaccctgtttcggtattctggaaaacagtttcccacaggtttgcagaagctgcc
tgtggtgtggtccatgtgatgctcaatggatcccgcagtaaaatctttgacaaaaacagc
acttttgggagtgtggaagtccataatttgcaaccagagaaggttcagacactagaggcc
tgggtgatacatggtggaagagaagattccagagacttatgccaggatcccaccataaaa
gagctggaatcgattataagcaaaaggaatattcagttttcctgcaagaatatctacaga
cctgacaagtttcttcagtgtgtgaaaagtcctgaggattcatcttgcatatctgagatc
tga

DBGET integrated database retrieval system