KEGG   Pongo abelii (Sumatran orangutan): 100458686
Entry
100458686         CDS       T01416                                 

Gene name
GNAQ
Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04062  Chemokine signaling pathway
pon04071  Sphingolipid signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon05010  Alzheimer disease
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05022  Pathways of neurodegeneration - multiple diseases
pon05135  Yersinia infection
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05146  Amoebiasis
pon05163  Human cytomegalovirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100458686 (GNAQ)
   04371 Apelin signaling pathway
    100458686 (GNAQ)
   04020 Calcium signaling pathway
    100458686 (GNAQ)
   04071 Sphingolipid signaling pathway
    100458686 (GNAQ)
   04022 cGMP-PKG signaling pathway
    100458686 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100458686 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100458686 (GNAQ)
   04062 Chemokine signaling pathway
    100458686 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    100458686 (GNAQ)
   04922 Glucagon signaling pathway
    100458686 (GNAQ)
   04929 GnRH secretion
    100458686 (GNAQ)
   04912 GnRH signaling pathway
    100458686 (GNAQ)
   04915 Estrogen signaling pathway
    100458686 (GNAQ)
   04921 Oxytocin signaling pathway
    100458686 (GNAQ)
   04935 Growth hormone synthesis, secretion and action
    100458686 (GNAQ)
   04918 Thyroid hormone synthesis
    100458686 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    100458686 (GNAQ)
   04916 Melanogenesis
    100458686 (GNAQ)
   04924 Renin secretion
    100458686 (GNAQ)
   04925 Aldosterone synthesis and secretion
    100458686 (GNAQ)
   04927 Cortisol synthesis and secretion
    100458686 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100458686 (GNAQ)
   04270 Vascular smooth muscle contraction
    100458686 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    100458686 (GNAQ)
   04971 Gastric acid secretion
    100458686 (GNAQ)
   04972 Pancreatic secretion
    100458686 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100458686 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    100458686 (GNAQ)
   04725 Cholinergic synapse
    100458686 (GNAQ)
   04728 Dopaminergic synapse
    100458686 (GNAQ)
   04726 Serotonergic synapse
    100458686 (GNAQ)
   04720 Long-term potentiation
    100458686 (GNAQ)
   04730 Long-term depression
    100458686 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    100458686 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100458686 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100458686 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100458686 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100458686 (GNAQ)
   05016 Huntington disease
    100458686 (GNAQ)
   05017 Spinocerebellar ataxia
    100458686 (GNAQ)
   05022 Pathways of neurodegeneration - multiple diseases
    100458686 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100458686 (GNAQ)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100458686 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100458686 (GNAQ)
   05163 Human cytomegalovirus infection
    100458686 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100458686 (GNAQ)
   05142 Chagas disease
    100458686 (GNAQ)
   05143 African trypanosomiasis
    100458686 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100458686 (GNAQ)
   04031 GTP-binding proteins [BR:pon04031]
    100458686 (GNAQ)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100458686 (GNAQ)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    100458686 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 100458686
NCBI-ProteinID: XP_002819934
Ensembl: ENSPPYG00000019311
UniProt: H2PSG4 A0A6D2WDJ0
LinkDB
Position
9
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagctcggcgg
atcaacgacgagatcgagcggcagctccgcagggacaagcgggacgcccgccgggagctc
aagctgctgctgctcgggacaggagagagtggcaagagtacgtttatcaagcagatgaga
atcatccatgggtcaggatactctgatgaagataaaaggggcttcaccaagctggtgtat
cagaacatcttcacggccatgcaggccatgatcagagccatggacacactcaagatccca
tacaagtatgagcacaataaggctcatgcgcaattagttcgagaagttgatgtggagaag
gtgtctgcttttgagaatccatatgtagatgcaataaagagtttatggaatgatcctgga
atccaggaatgctatgatagacgacgagaatatcaattatctgactctaccaaatactat
cttaatgacttggaccgcgtagctgaccctgcctacctgcctacgcaacaagatgtgctt
agagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagttctcgtg
gagtcagacaatgagaaccgaatggaggaaagcaaggctctctttagaacaattatcaca
tacccctggttccagaactcctcggttattctgttcttaaacaagaaagatcttctagag
gagaaaatcatgtattcccatctagtcgactacttcccagaatatgatggaccccagaga
gatgcccaggcagcccgagaattcattctgaagatgttcgtggacctgaacccagacagt
gacaaaattatctactcccacttcacatgcgccacagacaccgagaatatccgctttgtc
tttgctgccgtcaaggacaccatcctccagttgaacctgaaggagtacaatctggtctaa

KEGG   Pongo abelii (Sumatran orangutan): 100460338
Entry
100460338         CDS       T01416                                 

Gene name
GNA11
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04270  Vascular smooth muscle contraction
pon04540  Gap junction
pon04725  Cholinergic synapse
pon04730  Long-term depression
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon05142  Chagas disease
pon05146  Amoebiasis
pon05163  Human cytomegalovirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100460338 (GNA11)
   04022 cGMP-PKG signaling pathway
    100460338 (GNA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100460338 (GNA11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100460338 (GNA11)
   04929 GnRH secretion
    100460338 (GNA11)
   04912 GnRH signaling pathway
    100460338 (GNA11)
   04935 Growth hormone synthesis, secretion and action
    100460338 (GNA11)
   04928 Parathyroid hormone synthesis, secretion and action
    100460338 (GNA11)
   04925 Aldosterone synthesis and secretion
    100460338 (GNA11)
   04927 Cortisol synthesis and secretion
    100460338 (GNA11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100460338 (GNA11)
  09156 Nervous system
   04725 Cholinergic synapse
    100460338 (GNA11)
   04730 Long-term depression
    100460338 (GNA11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460338 (GNA11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100460338 (GNA11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100460338 (GNA11)
   05163 Human cytomegalovirus infection
    100460338 (GNA11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100460338 (GNA11)
   05142 Chagas disease
    100460338 (GNA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100460338 (GNA11)
   04031 GTP-binding proteins [BR:pon04031]
    100460338 (GNA11)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100460338 (GNA11)
  Exosomal proteins of melanoma cells
   100460338 (GNA11)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    100460338 (GNA11)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29
Other DBs
NCBI-GeneID: 100460338
NCBI-ProteinID: XP_024093386
Ensembl: ENSPPYG00000009366
LinkDB
Position
19
AA seq 359 aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVSAIKTLWEDPGIQECYDRRREYQLSDSAKYYLTDVDRIATSGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctgagcgatgaggtgaaggagtccaagcgg
atcaacgccgagatcgagaagcagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctgctcggcacgggcgagagcgggaagagcactttcatcaagcagatgcgc
atcatccacggcgccggctactcggaggaggacaagcgtggcttcaccaagctcgtctac
cagaacatcttcaccgccatgcaggccatgatccgggccatggagacgctcaagatcctc
tacaagtacgagcagaacaaggccaatgcgctcctgatccgggaggtggacgtggagaag
gtgaccaccttcgagcatcagtacgtcagcgccatcaagaccctgtgggaggacccgggc
atccaggaatgctacgaccgcaggcgcgagtaccagctctccgactccgccaagtactac
ctgaccgacgttgaccgcatcgccacctcgggctacctgcccacccagcaggacgtgctg
cgggtccgcgtgcccaccaccggcatcatcgagtaccctttcgacctggagaacatcatc
ttccggatggtggatgtggggggccagcggtcggagcggaggaagtggatccactgcttt
gagaacgtgacatccatcatgtttctcgtcgccctcagcgaatacgaccaagtcctggtg
gagtcggacaacgagaaccggatggaggagagcaaagccttgttccggaccatcatcacc
tacccctggttccagaactcctccgtcatcctcttcctcaacaagaaggacctgctggag
gacaagatcctgtactcgcacctggtggactacttccctgagttcgacgggccccagcgg
gacgcccaggcggcgcgggagttcatcctgaagatgtttgtggacctgaaccccgacagc
gacaagatcatctactcacacttcacgtgtgccaccgacacggagaacatccgcttcgtg
ttcgcggctgtgaaggacaccattctgcagctcaacctcaaggagtacaacctggtctga

DBGET integrated database retrieval system