KEGG   Pongo abelii (Sumatran orangutan): 100459446
Entry
100459446         CDS       T01416                                 

Gene name
AIM2
Definition
(RefSeq) interferon-inducible protein AIM2 isoform X2
  KO
K12966  absent in melanoma 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04621  NOD-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100459446 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    100459446 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon DUF2950 PDH_E1_M
Other DBs
NCBI-GeneID: 100459446
NCBI-ProteinID: XP_002810005
Ensembl: ENSPPYG00000000664
UniProt: A0A6D2VWB8 H2N578
LinkDB
Position
1
AA seq 343 aa
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVANLMIQNAGAMS
AVMKTIRIFQKLNYMLLAKRLQEEKEKVDKKYKSVTKPKPLSQAEMSPAASAAIRNDVTK
QRAAPKVSPHVKPEHKQMVAQQESIREGFQKGCLPVMVLKAKKPFTFETQEGKQEMFHAT
VATEKEFFFVKVFNTLLKDKFIPKRIIIISRYYRHSGFLEVNSASRVLDAESDQKVNVPL
NIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNVLFDLSDNTGKMEVLVVRNED
TMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAKKKT
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggagagtaaatacaaggagatactcttgctaacaggcctggataacatcactgatgag
gaactggataggtttaagttctttctttcagacgagtttaatatcgccacaggcaaacta
catactgcaaacagaatacaagtagctaacctgatgattcaaaatgctggggcgatgtct
gcagtgatgaagaccattcgtatttttcagaagttgaattatatgcttttggcaaaacgt
cttcaggaagagaaggagaaagttgataagaaatacaaatcggtaacaaaaccaaagcca
ctaagtcaagctgaaatgagtcctgctgcatctgcagccatcagaaatgatgtcacaaag
caacgtgctgcaccaaaagtctctcctcatgttaagcctgaacataaacagatggtggcc
cagcaggaatctatcagagaagggtttcagaaaggctgtttgccagttatggtactgaaa
gcaaagaagcccttcacgtttgagacccaagaaggcaagcaggagatgtttcatgctaca
gtcgctacagaaaaggaattcttctttgtaaaagtttttaatacactgctgaaagataaa
ttcattccaaagagaataatcataatatcaagatattatcggcacagtggtttcttagag
gtcaatagcgcctcacgtgtgttagatgctgaatctgaccaaaaggttaatgtcccgctg
aacattatcagaaaagctggtgaaaccccaaagatcaatacgcttcaaactcagcccctt
ggaacaattgtgaatggtttgtttgtagtccagaaggtaacagaaaagaagaaaaatgta
ttatttgacctaagtgacaacactgggaaaatggaagtactggtggttagaaatgaggac
acaatgaaatgtaaggaaggagataaggttcgacttacattcttcaccctgtcaaaaaat
ggagaaaaactacagctgacatctggagttcatagcaccataaaggttattaaggccaaa
aaaaaaacatag

DBGET integrated database retrieval system