KEGG   Pongo abelii (Sumatran orangutan): 100938429
Entry
100938429         CDS       T01416                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2 isoform X1
  KO
K02161  apoptosis regulator Bcl-2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04064  NF-kappa B signaling pathway
pon04066  HIF-1 signaling pathway
pon04071  Sphingolipid signaling pathway
pon04115  p53 signaling pathway
pon04140  Autophagy - animal
pon04141  Protein processing in endoplasmic reticulum
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04217  Necroptosis
pon04261  Adrenergic signaling in cardiomyocytes
pon04340  Hedgehog signaling pathway
pon04510  Focal adhesion
pon04621  NOD-like receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04915  Estrogen signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05014  Amyotrophic lateral sclerosis
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05162  Measles
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05215  Prostate cancer
pon05222  Small cell lung cancer
pon05226  Gastric cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100938429 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100938429 (BCL2)
   04630 JAK-STAT signaling pathway
    100938429 (BCL2)
   04064 NF-kappa B signaling pathway
    100938429 (BCL2)
   04066 HIF-1 signaling pathway
    100938429 (BCL2)
   04071 Sphingolipid signaling pathway
    100938429 (BCL2)
   04151 PI3K-Akt signaling pathway
    100938429 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100938429 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    100938429 (BCL2)
   04215 Apoptosis - multiple species
    100938429 (BCL2)
   04217 Necroptosis
    100938429 (BCL2)
   04115 p53 signaling pathway
    100938429 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100938429 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100938429 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100938429 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    100938429 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100938429 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    100938429 (BCL2)
   04722 Neurotrophin signaling pathway
    100938429 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100938429 (BCL2)
   05206 MicroRNAs in cancer
    100938429 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100938429 (BCL2)
   05226 Gastric cancer
    100938429 (BCL2)
   05215 Prostate cancer
    100938429 (BCL2)
   05222 Small cell lung cancer
    100938429 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100938429 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100938429 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100938429 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100938429 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100938429 (BCL2)
   05152 Tuberculosis
    100938429 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100938429 (BCL2)
   05161 Hepatitis B
    100938429 (BCL2)
   05162 Measles
    100938429 (BCL2)
   05168 Herpes simplex virus 1 infection
    100938429 (BCL2)
   05169 Epstein-Barr virus infection
    100938429 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100938429 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100938429 (BCL2)
   01524 Platinum drug resistance
    100938429 (BCL2)
   01522 Endocrine resistance
    100938429 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100938429 (BCL2)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100938429 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100938429
NCBI-ProteinID: XP_024091826
LinkDB
Position
18
AA seq 239 aa
MAHAGTTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAATAPGIFSSQPGHTPHPA
ASRDPVARTSPLPTPAAPGAAVGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 720 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggacaacagggtacgataaccgggagatagtgatgaagtacatccat
tataagttgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccccg
ggggccgccaccgcacccggcatcttctcctcccagcccgggcacacgcctcatccagcc
gcatcccgggacccggtcgccaggacctcgccgctgccgaccccggctgcccctggcgcc
gccgtggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggcc
ggcgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcac
ctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggac
ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag
agcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtac
ctgaaccggcacctgcacacctggatccaggataacggaggctgggatgcctttgtggaa
ctgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagactctg
ctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system