Pongo abelii (Sumatran orangutan): 100938429 Help Entry 100938429         CDS       T01416                                  Symbol BCL2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon01521   EGFR tyrosine kinase inhibitor resistance pon01522   Endocrine resistance pon01524   Platinum drug resistance pon04064   NF-kappa B signaling pathway pon04066   HIF-1 signaling pathway pon04071   Sphingolipid signaling pathway pon04115   p53 signaling pathway pon04140   Autophagy - animal pon04141   Protein processing in endoplasmic reticulum pon04151   PI3K-Akt signaling pathway pon04210   Apoptosis pon04215   Apoptosis - multiple species pon04217   Necroptosis pon04261   Adrenergic signaling in cardiomyocytes pon04340   Hedgehog signaling pathway pon04510   Focal adhesion pon04621   NOD-like receptor signaling pathway pon04630   JAK-STAT signaling pathway pon04722   Neurotrophin signaling pathway pon04725   Cholinergic synapse pon04915   Estrogen signaling pathway pon04928   Parathyroid hormone synthesis, secretion and action pon04933   AGE-RAGE signaling pathway in diabetic complications pon05014   Amyotrophic lateral sclerosis pon05022   Pathways of neurodegeneration - multiple diseases pon05132   Salmonella infection pon05145   Toxoplasmosis pon05152   Tuberculosis pon05161   Hepatitis B pon05162   Measles pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05200   Pathways in cancer pon05206   MicroRNAs in cancer pon05207   Chemical carcinogenesis - receptor activation pon05210   Colorectal cancer pon05215   Prostate cancer pon05222   Small cell lung cancer pon05226   Gastric cancer pon05417   Lipid and atherosclerosis pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100938429 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     100938429 (BCL2)    04630 JAK-STAT signaling pathway     100938429 (BCL2)    04064 NF-kappa B signaling pathway     100938429 (BCL2)    04066 HIF-1 signaling pathway     100938429 (BCL2)    04071 Sphingolipid signaling pathway     100938429 (BCL2)    04151 PI3K-Akt signaling pathway     100938429 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100938429 (BCL2)   09143 Cell growth and death    04210 Apoptosis     100938429 (BCL2)    04215 Apoptosis - multiple species     100938429 (BCL2)    04217 Necroptosis     100938429 (BCL2)    04115 p53 signaling pathway     100938429 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100938429 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100938429 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     100938429 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     100938429 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100938429 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     100938429 (BCL2)    04722 Neurotrophin signaling pathway     100938429 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100938429 (BCL2)    05206 MicroRNAs in cancer     100938429 (BCL2)    05207 Chemical carcinogenesis - receptor activation     100938429 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     100938429 (BCL2)    05226 Gastric cancer     100938429 (BCL2)    05215 Prostate cancer     100938429 (BCL2)    05222 Small cell lung cancer     100938429 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100938429 (BCL2)    05161 Hepatitis B     100938429 (BCL2)    05162 Measles     100938429 (BCL2)    05168 Herpes simplex virus 1 infection     100938429 (BCL2)    05169 Epstein-Barr virus infection     100938429 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     100938429 (BCL2)    05152 Tuberculosis     100938429 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100938429 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100938429 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     100938429 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100938429 (BCL2)    05418 Fluid shear stress and atherosclerosis     100938429 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100938429 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100938429 (BCL2)    01524 Platinum drug resistance     100938429 (BCL2)    01522 Endocrine resistance     100938429 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pon01009]     100938429 (BCL2) Protein phosphatases and associated proteins [BR:pon01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      100938429 (BCL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 ARMH5 Motif Other DBs NCBI-GeneID:  100938429 NCBI-ProteinID:  XP_024091826 Ensembl:  ENSPPYG00000037186 UniProt:  A0A2J8W3J1 LinkDB All DBs Position 17:complement(77953412..78152514) Genome browser AA seq 239 aa AA seqDB search MAHAGTTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAATAPGIFSSQPGHTPHPA ASRDPVARTSPLPTPAAPGAAVGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK NT seq 720 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggacaacagggtacgataaccgggagatagtgatgaagtacatccat tataagttgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccccg ggggccgccaccgcacccggcatcttctcctcccagcccgggcacacgcctcatccagcc gcatcccgggacccggtcgccaggacctcgccgctgccgaccccggctgcccctggcgcc gccgtggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggcc ggcgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcac ctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggac ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag agcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtac ctgaaccggcacctgcacacctggatccaggataacggaggctgggatgcctttgtggaa ctgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagactctg ctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system