Panthera pardus (leopard): 109261148 Help Entry 109261148         CDS       T06062                                  Symbol IKBKG Name (RefSeq) NF-kappa-B essential modulator   KO K07210   inhibitor of nuclear factor kappa-B kinase subunit gamma Organism ppad  Panthera pardus (leopard) Pathway ppad01523   Antifolate resistance ppad04010   MAPK signaling pathway ppad04014   Ras signaling pathway ppad04062   Chemokine signaling pathway ppad04064   NF-kappa B signaling pathway ppad04151   PI3K-Akt signaling pathway ppad04210   Apoptosis ppad04380   Osteoclast differentiation ppad04620   Toll-like receptor signaling pathway ppad04621   NOD-like receptor signaling pathway ppad04622   RIG-I-like receptor signaling pathway ppad04623   Cytosolic DNA-sensing pathway ppad04625   C-type lectin receptor signaling pathway ppad04657   IL-17 signaling pathway ppad04658   Th1 and Th2 cell differentiation ppad04659   Th17 cell differentiation ppad04660   T cell receptor signaling pathway ppad04662   B cell receptor signaling pathway ppad04668   TNF signaling pathway ppad04920   Adipocytokine signaling pathway ppad04936   Alcoholic liver disease ppad05010   Alzheimer disease ppad05132   Salmonella infection ppad05135   Yersinia infection ppad05142   Chagas disease ppad05145   Toxoplasmosis ppad05160   Hepatitis C ppad05161   Hepatitis B ppad05162   Measles ppad05163   Human cytomegalovirus infection ppad05164   Influenza A ppad05165   Human papillomavirus infection ppad05166   Human T-cell leukemia virus 1 infection ppad05167   Kaposi sarcoma-associated herpesvirus infection ppad05168   Herpes simplex virus 1 infection ppad05169   Epstein-Barr virus infection ppad05170   Human immunodeficiency virus 1 infection ppad05171   Coronavirus disease - COVID-19 ppad05200   Pathways in cancer ppad05203   Viral carcinogenesis ppad05208   Chemical carcinogenesis - reactive oxygen species ppad05212   Pancreatic cancer ppad05215   Prostate cancer ppad05220   Chronic myeloid leukemia ppad05221   Acute myeloid leukemia ppad05222   Small cell lung cancer ppad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ppad05340   Primary immunodeficiency ppad05417   Lipid and atherosclerosis ppad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109261148 (IKBKG)    04014 Ras signaling pathway     109261148 (IKBKG)    04064 NF-kappa B signaling pathway     109261148 (IKBKG)    04668 TNF signaling pathway     109261148 (IKBKG)    04151 PI3K-Akt signaling pathway     109261148 (IKBKG)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109261148 (IKBKG)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109261148 (IKBKG)    04621 NOD-like receptor signaling pathway     109261148 (IKBKG)    04622 RIG-I-like receptor signaling pathway     109261148 (IKBKG)    04623 Cytosolic DNA-sensing pathway     109261148 (IKBKG)    04625 C-type lectin receptor signaling pathway     109261148 (IKBKG)    04660 T cell receptor signaling pathway     109261148 (IKBKG)    04658 Th1 and Th2 cell differentiation     109261148 (IKBKG)    04659 Th17 cell differentiation     109261148 (IKBKG)    04657 IL-17 signaling pathway     109261148 (IKBKG)    04662 B cell receptor signaling pathway     109261148 (IKBKG)    04062 Chemokine signaling pathway     109261148 (IKBKG)   09152 Endocrine system    04920 Adipocytokine signaling pathway     109261148 (IKBKG)   09158 Development and regeneration    04380 Osteoclast differentiation     109261148 (IKBKG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109261148 (IKBKG)    05208 Chemical carcinogenesis - reactive oxygen species     109261148 (IKBKG)    05203 Viral carcinogenesis     109261148 (IKBKG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109261148 (IKBKG)   09162 Cancer: specific types    05212 Pancreatic cancer     109261148 (IKBKG)    05221 Acute myeloid leukemia     109261148 (IKBKG)    05220 Chronic myeloid leukemia     109261148 (IKBKG)    05215 Prostate cancer     109261148 (IKBKG)    05222 Small cell lung cancer     109261148 (IKBKG)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109261148 (IKBKG)    05170 Human immunodeficiency virus 1 infection     109261148 (IKBKG)    05161 Hepatitis B     109261148 (IKBKG)    05160 Hepatitis C     109261148 (IKBKG)    05171 Coronavirus disease - COVID-19     109261148 (IKBKG)    05164 Influenza A     109261148 (IKBKG)    05162 Measles     109261148 (IKBKG)    05168 Herpes simplex virus 1 infection     109261148 (IKBKG)    05163 Human cytomegalovirus infection     109261148 (IKBKG)    05167 Kaposi sarcoma-associated herpesvirus infection     109261148 (IKBKG)    05169 Epstein-Barr virus infection     109261148 (IKBKG)    05165 Human papillomavirus infection     109261148 (IKBKG)   09171 Infectious disease: bacterial    05132 Salmonella infection     109261148 (IKBKG)    05135 Yersinia infection     109261148 (IKBKG)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     109261148 (IKBKG)    05142 Chagas disease     109261148 (IKBKG)   09163 Immune disease    05340 Primary immunodeficiency     109261148 (IKBKG)   09164 Neurodegenerative disease    05010 Alzheimer disease     109261148 (IKBKG)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109261148 (IKBKG)    05418 Fluid shear stress and atherosclerosis     109261148 (IKBKG)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     109261148 (IKBKG)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     109261148 (IKBKG)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ppad01001]     109261148 (IKBKG) Protein kinases [BR:ppad01001]  Serine/threonine kinases: Other   IKK family [OT]    109261148 (IKBKG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NEMO CC2-LZ zf_C2H2_10 Zn_SUZ12 Nairovirus_NSm ABC_membrane_2 Laminin_I Motif Other DBs NCBI-GeneID:  109261148 NCBI-ProteinID:  XP_019295256 Ensembl:  ENSPPRG00000017843 LinkDB All DBs Position Unknown AA seq 424 aa AA seqDB search MSTTGETLTCWMSRPPWKSQLCEMVQPSGGPAGDQDVLGEESSLGKPAMPHLPSEQGTPE TFQRCVEENQELRDAIRQSNQMLRERCEELQRFQGSQRKEKEFLMQKFQEARKLVERLSL EKLDLRRQREQALQEVEHLKRCQKQLAEDKASVKAQVTSLLGELQESQSRLEAAIKERQA LEGRARAASEQARQLESEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQ LQVAYHQLFQEYDSHVKSSVVSSERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAE QHKIVMETVPVLKAQADIYKADFQAERQAREKLAXLRSVPSPPLLALVDLAVFSFQRIED MRKRHVEASQAPVAPAPAHPSFHLALPNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVM ECIE NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt atgtcaaccacgggagagaccctgacttgttggatgagcaggcccccctggaagagtcag ctgtgtgagatggtgcagcccagcggcggcccggcaggggaccaggacgtgctgggtgaa gagtcttctctggggaagccagctatgccccacctaccttctgagcagggcactcctgag accttccaacgctgtgtggaggagaatcaagagctccgagatgccatccggcagagcaac cagatgcttcgggagcgctgtgaggagctgcagcgtttccaaggcagccagaggaaggag aaggagttcctcatgcagaaattccaggaagccaggaaactggtggagagactgagcctg gagaagctcgacctgaggaggcagagggagcaggcccttcaggaggtggaacatctgaag agatgccagaagcagttggctgaggacaaggcgtcagtgaaagcccaggtgacgtccttg ctgggggagctccaagagagccagagtcgcttggaggccgccatcaaagagcggcaggct ttggagggcagggcccgggctgccagcgagcaggcccggcagctggagagcgagcgggag gccctgcagcagcagcacagcgtgcaggtggaccagctgcgcatgcagagccagagcgtg gaggccgcgctgcgcatggagcgccaggccgcctcggaggagaagcggaagctggcacag ctacaggtggcctatcaccagctcttccaggagtacgacagccacgtcaagagcagcgtg gtgagcagcgagcggaaccgaggactgcagctggaggacctgaagcagcagctgcaacag gccgaggaggccctggtggccaagcaggaagtgattgacaagctgaaggaagaggccgag cagcacaagatagtgatggagaccgttccagtgctaaaagcccaggcggacatctacaag gccgacttccaggccgagaggcaggcccgggagaagctggccgancttcggtccgtcccc tctccccctttacttgcactcgttgatctggccgttttttcttttcaaaggattgaagat atgaggaagcggcacgtggaggcctcccaggcccccgtagcccccgccccagctcacccc tccttccacctggccctgcccaaccagaggagaagcccccccgaggagccgcctgacttc tgttgccccaagtgccagtatcaggctcccgatatggacaccctgcagatacatgtcatg gagtgcatcgagtag

DBGET integrated database retrieval system