KEGG   Panthera pardus (leopard): 109261148
Entry
109261148         CDS       T06062                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad01523  Antifolate resistance
ppad04010  MAPK signaling pathway
ppad04014  Ras signaling pathway
ppad04062  Chemokine signaling pathway
ppad04064  NF-kappa B signaling pathway
ppad04151  PI3K-Akt signaling pathway
ppad04210  Apoptosis
ppad04380  Osteoclast differentiation
ppad04620  Toll-like receptor signaling pathway
ppad04621  NOD-like receptor signaling pathway
ppad04622  RIG-I-like receptor signaling pathway
ppad04623  Cytosolic DNA-sensing pathway
ppad04625  C-type lectin receptor signaling pathway
ppad04657  IL-17 signaling pathway
ppad04658  Th1 and Th2 cell differentiation
ppad04659  Th17 cell differentiation
ppad04660  T cell receptor signaling pathway
ppad04662  B cell receptor signaling pathway
ppad04668  TNF signaling pathway
ppad04920  Adipocytokine signaling pathway
ppad05132  Salmonella infection
ppad05135  Yersinia infection
ppad05142  Chagas disease
ppad05145  Toxoplasmosis
ppad05160  Hepatitis C
ppad05161  Hepatitis B
ppad05162  Measles
ppad05163  Human cytomegalovirus infection
ppad05164  Influenza A
ppad05165  Human papillomavirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05167  Kaposi sarcoma-associated herpesvirus infection
ppad05168  Herpes simplex virus 1 infection
ppad05169  Epstein-Barr virus infection
ppad05170  Human immunodeficiency virus 1 infection
ppad05200  Pathways in cancer
ppad05203  Viral carcinogenesis
ppad05212  Pancreatic cancer
ppad05215  Prostate cancer
ppad05220  Chronic myeloid leukemia
ppad05221  Acute myeloid leukemia
ppad05222  Small cell lung cancer
ppad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ppad05340  Primary immunodeficiency
ppad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109261148 (IKBKG)
   04014 Ras signaling pathway
    109261148 (IKBKG)
   04064 NF-kappa B signaling pathway
    109261148 (IKBKG)
   04668 TNF signaling pathway
    109261148 (IKBKG)
   04151 PI3K-Akt signaling pathway
    109261148 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109261148 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109261148 (IKBKG)
   04621 NOD-like receptor signaling pathway
    109261148 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    109261148 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    109261148 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    109261148 (IKBKG)
   04660 T cell receptor signaling pathway
    109261148 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    109261148 (IKBKG)
   04659 Th17 cell differentiation
    109261148 (IKBKG)
   04657 IL-17 signaling pathway
    109261148 (IKBKG)
   04662 B cell receptor signaling pathway
    109261148 (IKBKG)
   04062 Chemokine signaling pathway
    109261148 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109261148 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109261148 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109261148 (IKBKG)
   05203 Viral carcinogenesis
    109261148 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109261148 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109261148 (IKBKG)
   05221 Acute myeloid leukemia
    109261148 (IKBKG)
   05220 Chronic myeloid leukemia
    109261148 (IKBKG)
   05215 Prostate cancer
    109261148 (IKBKG)
   05222 Small cell lung cancer
    109261148 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    109261148 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109261148 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109261148 (IKBKG)
   05135 Yersinia infection
    109261148 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109261148 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    109261148 (IKBKG)
   05162 Measles
    109261148 (IKBKG)
   05164 Influenza A
    109261148 (IKBKG)
   05161 Hepatitis B
    109261148 (IKBKG)
   05160 Hepatitis C
    109261148 (IKBKG)
   05168 Herpes simplex virus 1 infection
    109261148 (IKBKG)
   05163 Human cytomegalovirus infection
    109261148 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109261148 (IKBKG)
   05169 Epstein-Barr virus infection
    109261148 (IKBKG)
   05165 Human papillomavirus infection
    109261148 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109261148 (IKBKG)
   05142 Chagas disease
    109261148 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109261148 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppad01001]
    109261148 (IKBKG)
Protein kinases [BR:ppad01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   109261148 (IKBKG)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 Bacillus_HBL ABC_membrane_2
Other DBs
NCBI-GeneID: 109261148
NCBI-ProteinID: XP_019295256
Ensembl: ENSPPRG00000017843
LinkDB
Position
Unknown
AA seq 424 aa
MSTTGETLTCWMSRPPWKSQLCEMVQPSGGPAGDQDVLGEESSLGKPAMPHLPSEQGTPE
TFQRCVEENQELRDAIRQSNQMLRERCEELQRFQGSQRKEKEFLMQKFQEARKLVERLSL
EKLDLRRQREQALQEVEHLKRCQKQLAEDKASVKAQVTSLLGELQESQSRLEAAIKERQA
LEGRARAASEQARQLESEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQ
LQVAYHQLFQEYDSHVKSSVVSSERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAE
QHKIVMETVPVLKAQADIYKADFQAERQAREKLAXLRSVPSPPLLALVDLAVFSFQRIED
MRKRHVEASQAPVAPAPAHPSFHLALPNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVM
ECIE
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgtcaaccacgggagagaccctgacttgttggatgagcaggcccccctggaagagtcag
ctgtgtgagatggtgcagcccagcggcggcccggcaggggaccaggacgtgctgggtgaa
gagtcttctctggggaagccagctatgccccacctaccttctgagcagggcactcctgag
accttccaacgctgtgtggaggagaatcaagagctccgagatgccatccggcagagcaac
cagatgcttcgggagcgctgtgaggagctgcagcgtttccaaggcagccagaggaaggag
aaggagttcctcatgcagaaattccaggaagccaggaaactggtggagagactgagcctg
gagaagctcgacctgaggaggcagagggagcaggcccttcaggaggtggaacatctgaag
agatgccagaagcagttggctgaggacaaggcgtcagtgaaagcccaggtgacgtccttg
ctgggggagctccaagagagccagagtcgcttggaggccgccatcaaagagcggcaggct
ttggagggcagggcccgggctgccagcgagcaggcccggcagctggagagcgagcgggag
gccctgcagcagcagcacagcgtgcaggtggaccagctgcgcatgcagagccagagcgtg
gaggccgcgctgcgcatggagcgccaggccgcctcggaggagaagcggaagctggcacag
ctacaggtggcctatcaccagctcttccaggagtacgacagccacgtcaagagcagcgtg
gtgagcagcgagcggaaccgaggactgcagctggaggacctgaagcagcagctgcaacag
gccgaggaggccctggtggccaagcaggaagtgattgacaagctgaaggaagaggccgag
cagcacaagatagtgatggagaccgttccagtgctaaaagcccaggcggacatctacaag
gccgacttccaggccgagaggcaggcccgggagaagctggccgancttcggtccgtcccc
tctccccctttacttgcactcgttgatctggccgttttttcttttcaaaggattgaagat
atgaggaagcggcacgtggaggcctcccaggcccccgtagcccccgccccagctcacccc
tccttccacctggccctgcccaaccagaggagaagcccccccgaggagccgcctgacttc
tgttgccccaagtgccagtatcaggctcccgatatggacaccctgcagatacatgtcatg
gagtgcatcgagtag

DBGET integrated database retrieval system