KEGG   Pan paniscus (bonobo): 100987483
Entry
100987483         CDS       T02283                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01523  Antifolate resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04062  Chemokine signaling pathway
pps04064  NF-kappa B signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04380  Osteoclast differentiation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04668  TNF signaling pathway
pps04920  Adipocytokine signaling pathway
pps05132  Salmonella infection
pps05135  Yersinia infection
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05212  Pancreatic cancer
pps05215  Prostate cancer
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05222  Small cell lung cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05340  Primary immunodeficiency
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100987483 (IKBKG)
   04014 Ras signaling pathway
    100987483 (IKBKG)
   04064 NF-kappa B signaling pathway
    100987483 (IKBKG)
   04668 TNF signaling pathway
    100987483 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100987483 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100987483 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100987483 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100987483 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100987483 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100987483 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100987483 (IKBKG)
   04660 T cell receptor signaling pathway
    100987483 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100987483 (IKBKG)
   04659 Th17 cell differentiation
    100987483 (IKBKG)
   04657 IL-17 signaling pathway
    100987483 (IKBKG)
   04662 B cell receptor signaling pathway
    100987483 (IKBKG)
   04062 Chemokine signaling pathway
    100987483 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100987483 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100987483 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100987483 (IKBKG)
   05203 Viral carcinogenesis
    100987483 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100987483 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100987483 (IKBKG)
   05221 Acute myeloid leukemia
    100987483 (IKBKG)
   05220 Chronic myeloid leukemia
    100987483 (IKBKG)
   05215 Prostate cancer
    100987483 (IKBKG)
   05222 Small cell lung cancer
    100987483 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100987483 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100987483 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100987483 (IKBKG)
   05135 Yersinia infection
    100987483 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100987483 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100987483 (IKBKG)
   05162 Measles
    100987483 (IKBKG)
   05164 Influenza A
    100987483 (IKBKG)
   05161 Hepatitis B
    100987483 (IKBKG)
   05160 Hepatitis C
    100987483 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100987483 (IKBKG)
   05163 Human cytomegalovirus infection
    100987483 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100987483 (IKBKG)
   05169 Epstein-Barr virus infection
    100987483 (IKBKG)
   05165 Human papillomavirus infection
    100987483 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100987483 (IKBKG)
   05142 Chagas disease
    100987483 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100987483 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100987483 (IKBKG)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100987483 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 LLC1 zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 100987483
NCBI-ProteinID: XP_008951069
LinkDB
Position
X
AA seq 307 aa
MAGVGRWGESSADRKWLFILQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG
RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV
AYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHK
IVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR
IEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQI
HVMECIE
NT seq 924 nt   +upstreamnt  +downstreamnt
atggcaggagtgggccgctggggagaaagcagtgctgacaggaagtggctttttatcctg
cagcagatggctgaggacaaggcctctgtgaaagcccaggtgacgtccttgctcggggag
ctgcaggagagccagagtcgcttggaggctgccactaaggaatgccaggctctggagggt
cgggcccgggcggccagcgagcaggcgcggcagctggagagtgagcgcgaggcgctgcag
cagcagcacagcgtgcaggtggaccagctgcgcatgcagggccagagcgtggaggccgcg
ctccgcatggagcgccaggccgcctcggaggagaagaggaagctggcccagttgcaggtg
gcctatcaccagctcttccaagaatacgacaaccacatcaagagcagcgtggtgggcagt
gagcggaagcgaggaatgcagctggaagatctcaaacagcagctccagcaggccgaggag
gccctggtggccaaacaggaggtgatcgataagctgaaggaggaggccgagcagcacaag
attgtgatggagaccgttccggtgctgaaggcccaggcggatatctacaaggcggacttc
caggctgagaggcaggcccgggagaagctggctgagaagaaggagctcctgcaggagcag
ctggagcagctgcagagggagtacagcaaactgaaggccagctgtcaggagtcggccagg
atcgaggacatgaggaagcggcatgtcgaggtctcccaggcccccttgccccccgcccct
gcctacctctcctctcccctggccctgcccagccagaggaggagcccccccgaggagcca
cctgacttctgctgtcccaagtgccagtatcaggcccctgatatggacaccctgcagata
catgtcatggagtgcattgagtag

DBGET integrated database retrieval system