Pan paniscus (bonobo): 100988878 Help Entry 100988878         CDS       T02283                                  Gene name IL4 Definition (RefSeq) interleukin 4   KO K05430   interleukin 4 Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04151   PI3K-Akt signaling pathway pps04630   JAK-STAT signaling pathway pps04640   Hematopoietic cell lineage pps04657   IL-17 signaling pathway pps04658   Th1 and Th2 cell differentiation pps04659   Th17 cell differentiation pps04660   T cell receptor signaling pathway pps04664   Fc epsilon RI signaling pathway pps04672   Intestinal immune network for IgA production pps05140   Leishmaniasis pps05200   Pathways in cancer pps05310   Asthma pps05320   Autoimmune thyroid disease pps05321   Inflammatory bowel disease pps05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100988878 (IL4)    04151 PI3K-Akt signaling pathway     100988878 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100988878 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100988878 (IL4)    04660 T cell receptor signaling pathway     100988878 (IL4)    04658 Th1 and Th2 cell differentiation     100988878 (IL4)    04659 Th17 cell differentiation     100988878 (IL4)    04657 IL-17 signaling pathway     100988878 (IL4)    04664 Fc epsilon RI signaling pathway     100988878 (IL4)    04672 Intestinal immune network for IgA production     100988878 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100988878 (IL4)   09163 Immune disease    05310 Asthma     100988878 (IL4)    05320 Autoimmune thyroid disease     100988878 (IL4)    05321 Inflammatory bowel disease     100988878 (IL4)    05330 Allograft rejection     100988878 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100988878 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:pps04052]     100988878 (IL4)    00536 Glycosaminoglycan binding proteins [BR:pps00536]     100988878 (IL4) Cytokines and growth factors [BR:pps04052]  Cytokines   Interleukins    100988878 (IL4) Glycosaminoglycan binding proteins [BR:pps00536]  Heparan sulfate / Haparin   Cytokines    100988878 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Mannosyl_trans3 Motif Other DBs NCBI-GeneID:  100988878 NCBI-ProteinID:  XP_003829346 UniProt:  A0A2R8ZXQ5 LinkDB All DBs Position 5 AA seq 153 aa AA seqDB search MGLTSQLLPPLFFLLACAGNFVHGHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAAS KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL NSCPVKEANQSTLEDFLERLKTIMREKYSKCSS NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac tttgtccacggacacaagtgcgatatcaccttacaggagatcatcaaaactttgaacagc ctcacagagcagaagactctgtgcaccgagttgaccgtaacggacatctttgctgcctcc aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac agccaccatgagaaggacactcgctgcctgggtgcgactgcacagcagttccacaggcac aagcagctgatccgattcctgaaacggctcgacaggaacctctggggcctggcgggcttg aattcctgtcctgtgaaggaagccaaccagagtacgttggaagacttcttggaaaggcta aagacgatcatgagagagaaatattcaaagtgttcgagctga

DBGET integrated database retrieval system