KEGG   Pan paniscus (bonobo): 100988878
Entry
100988878         CDS       T02283                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04151  PI3K-Akt signaling pathway
pps04630  JAK-STAT signaling pathway
pps04640  Hematopoietic cell lineage
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04672  Intestinal immune network for IgA production
pps05140  Leishmaniasis
pps05200  Pathways in cancer
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100988878 (IL4)
   04151 PI3K-Akt signaling pathway
    100988878 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100988878 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100988878 (IL4)
   04660 T cell receptor signaling pathway
    100988878 (IL4)
   04658 Th1 and Th2 cell differentiation
    100988878 (IL4)
   04659 Th17 cell differentiation
    100988878 (IL4)
   04657 IL-17 signaling pathway
    100988878 (IL4)
   04664 Fc epsilon RI signaling pathway
    100988878 (IL4)
   04672 Intestinal immune network for IgA production
    100988878 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100988878 (IL4)
  09163 Immune disease
   05310 Asthma
    100988878 (IL4)
   05320 Autoimmune thyroid disease
    100988878 (IL4)
   05321 Inflammatory bowel disease
    100988878 (IL4)
   05330 Allograft rejection
    100988878 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100988878 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100988878 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100988878 (IL4)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100988878 (IL4)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Haparin
  Cytokines
   100988878 (IL4)
SSDB
Motif
Pfam: IL4 Mannosyl_trans3
Other DBs
NCBI-GeneID: 100988878
NCBI-ProteinID: XP_003829346
UniProt: A0A2R8ZXQ5
LinkDB
Position
5
AA seq 153 aa
MGLTSQLLPPLFFLLACAGNFVHGHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL
NSCPVKEANQSTLEDFLERLKTIMREKYSKCSS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac
tttgtccacggacacaagtgcgatatcaccttacaggagatcatcaaaactttgaacagc
ctcacagagcagaagactctgtgcaccgagttgaccgtaacggacatctttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcgctgcctgggtgcgactgcacagcagttccacaggcac
aagcagctgatccgattcctgaaacggctcgacaggaacctctggggcctggcgggcttg
aattcctgtcctgtgaaggaagccaaccagagtacgttggaagacttcttggaaaggcta
aagacgatcatgagagagaaatattcaaagtgttcgagctga

DBGET integrated database retrieval system