Pan paniscus (bonobo): 100992951 Help Entry 100992951         CDS       T02283                                  Symbol BCL2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism pps  Pan paniscus (bonobo) Pathway pps01521   EGFR tyrosine kinase inhibitor resistance pps01522   Endocrine resistance pps01524   Platinum drug resistance pps04064   NF-kappa B signaling pathway pps04066   HIF-1 signaling pathway pps04071   Sphingolipid signaling pathway pps04115   p53 signaling pathway pps04140   Autophagy - animal pps04141   Protein processing in endoplasmic reticulum pps04151   PI3K-Akt signaling pathway pps04210   Apoptosis pps04215   Apoptosis - multiple species pps04217   Necroptosis pps04261   Adrenergic signaling in cardiomyocytes pps04340   Hedgehog signaling pathway pps04510   Focal adhesion pps04621   NOD-like receptor signaling pathway pps04630   JAK-STAT signaling pathway pps04722   Neurotrophin signaling pathway pps04725   Cholinergic synapse pps04915   Estrogen signaling pathway pps04928   Parathyroid hormone synthesis, secretion and action pps04933   AGE-RAGE signaling pathway in diabetic complications pps05014   Amyotrophic lateral sclerosis pps05022   Pathways of neurodegeneration - multiple diseases pps05132   Salmonella infection pps05145   Toxoplasmosis pps05152   Tuberculosis pps05161   Hepatitis B pps05162   Measles pps05168   Herpes simplex virus 1 infection pps05169   Epstein-Barr virus infection pps05170   Human immunodeficiency virus 1 infection pps05200   Pathways in cancer pps05206   MicroRNAs in cancer pps05207   Chemical carcinogenesis - receptor activation pps05210   Colorectal cancer pps05215   Prostate cancer pps05222   Small cell lung cancer pps05226   Gastric cancer pps05417   Lipid and atherosclerosis pps05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100992951 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     100992951 (BCL2)    04630 JAK-STAT signaling pathway     100992951 (BCL2)    04064 NF-kappa B signaling pathway     100992951 (BCL2)    04066 HIF-1 signaling pathway     100992951 (BCL2)    04071 Sphingolipid signaling pathway     100992951 (BCL2)    04151 PI3K-Akt signaling pathway     100992951 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100992951 (BCL2)   09143 Cell growth and death    04210 Apoptosis     100992951 (BCL2)    04215 Apoptosis - multiple species     100992951 (BCL2)    04217 Necroptosis     100992951 (BCL2)    04115 p53 signaling pathway     100992951 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100992951 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100992951 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     100992951 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     100992951 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100992951 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     100992951 (BCL2)    04722 Neurotrophin signaling pathway     100992951 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100992951 (BCL2)    05206 MicroRNAs in cancer     100992951 (BCL2)    05207 Chemical carcinogenesis - receptor activation     100992951 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     100992951 (BCL2)    05226 Gastric cancer     100992951 (BCL2)    05215 Prostate cancer     100992951 (BCL2)    05222 Small cell lung cancer     100992951 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100992951 (BCL2)    05161 Hepatitis B     100992951 (BCL2)    05162 Measles     100992951 (BCL2)    05168 Herpes simplex virus 1 infection     100992951 (BCL2)    05169 Epstein-Barr virus infection     100992951 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     100992951 (BCL2)    05152 Tuberculosis     100992951 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100992951 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100992951 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     100992951 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100992951 (BCL2)    05418 Fluid shear stress and atherosclerosis     100992951 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100992951 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100992951 (BCL2)    01524 Platinum drug resistance     100992951 (BCL2)    01522 Endocrine resistance     100992951 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pps01009]     100992951 (BCL2) Protein phosphatases and associated proteins [BR:pps01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      100992951 (BCL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 ARMH5 Motif Other DBs NCBI-GeneID:  100992951 NCBI-ProteinID:  XP_034799806 Ensembl:  ENSPPAG00000032001 LinkDB All DBs Position 17:complement(80632173..80830186) Genome browser AA seq 239 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK NT seq 720 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccat tataagctgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccccg ggggccgcccccgcaccgggcatcttctcctcccagcccgggcacacgccccatccagcc gcatcccgggacccggtcgccaggacctcgccgctgcagaccccggctgcccccggcgcc gccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggcc ggcgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcac ctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggac ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag agcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtac ctgaaccggcacctgcacacctggatccaggataacggaggctgggatgcctttgtggaa ctgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagactctg ctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system