KEGG   Prevotella sp. oral taxon 299: HMPREF0669_00771Help
Entry
HMPREF0669_00771  CDS       T02809                                 

Definition
(GenBank) hypothetical protein
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
pro  Prevotella sp. oral taxon 299
Pathway
pro00500  Starch and sucrose metabolism
pro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0669_00771
Enzymes [BR:pro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     HMPREF0669_00771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: EFC71066
UniProt: D3IBG7
LinkDB All DBs
Position
unnamed:complement(1322990..1325122)
Genome map
AA seq 710 aa AA seqDB search
MKIVSLCLCALMMPLLLLAQQVKSPNGNVVVSFSLTDNGVPTYQVSYKGKAVIKPSHLGL
ELTPSKHDGIKAEDTNLMNGFKVTKTETSTFKETWKPVWGETNSILNHYNEMAVSLTQEH
PNRTMIVRFRVYNDGMGLRYEFPRQNNLSYFIIKDEHTQFAMAGDHTAWWIPGDYDTQEY
ETITSKLSDIRSKMKEAITDNASQTTFSPTGVQTSLQMKSSDGLYINLHEAACVDYPTMH
LNLDDKNMVFESWLTPDPTGNKAYMQAPRTTPWRTLIVSDDARDMLSSNLILNLNEPCKL
EDTSWIKPVKYCGVWWEMIVGKKSWSYTDEFPAVELGVTDFAKAKPNGRHAATNAEVKRY
IDFAAKNGLDQVLVEGWNIGWEDWFGHSKFKVFDFQTPYPDFDIKELNEYAHSKGIKLIM
HHETSSSMINYERYMEDAYKLMNKYGYNAVKSGYVGDIIPRGEHHYGQVMNNHYLYAVTE
AAKHKIMVNAHEATRPTGLCRTYPNLIGNESARGTEYEAFGGSNPDHTVILPFTRLQGGP
MDYTPGIFETKLKDWSDNNSYVHSTLAGQLALYLVMYSPLQMAADLPEHYEKYSDAFQFI
RDVAVDWDDSKYIEAEPGDYITVARKAKGTNNWFIGGKCDENGHKAVIKLDFLDKGKTYE
CTIYSDAPNADYDKNPKAYTITRKHVKYGDVLKINEAPGGGFGVSLFPKK
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagtttctttatgcttgtgtgcactaatgatgcctttattacttctcgcacag
caagtaaagtcgcccaatggcaatgtagtggtttcgttttcattaacagacaatggcgtt
cccacttatcaagtatcttataaaggtaaagcagttataaaaccatctcatttaggattg
gaattaactccctcaaaacacgatggcataaaagcagaagataccaacttaatgaatggt
ttcaaagtcacaaaaaccgaaacttcaaccttcaaagaaacatggaaaccagtgtgggga
gaaacaaatagcatcttaaatcactataacgagatggctgtttcactaacacaagaacac
cccaaccgcaccatgattgttcgtttccgtgtgtataacgatggtatgggcttgcgttat
gaattcccacgtcaaaacaatttgagctatttcattataaaagacgaacacactcaattt
gcaatggcaggagatcatactgcttggtggattccaggagactatgatacacaagaatat
gaaacgataacttcaaagttatccgacatccgttcaaagatgaaagaagcaataacagat
aacgcttcgcaaacaactttctcaccaactggtgtccaaacatctctacaaatgaagagt
tcagatggtttatacatcaatcttcacgaagctgcatgcgtagattatccaacaatgcac
cttaatttagatgacaaaaatatggtgtttgagtcgtggttaacaccagatccaacagga
aacaaggcatatatgcaagccccacgcaccactccttggcgtacacttatcgttagtgat
gatgcaagagatatgctttcatctaatctaatccttaatcttaatgagccatgtaagctc
gaagacacttcatggataaagcccgtgaaatattgtggcgtatggtgggagatgatagta
ggcaagaaaagctggagttatacagacgaattccctgctgttgaacttggagttacagat
tttgctaaagctaaaccaaacggaagacatgcggcaacaaatgctgaagtgaaacgttat
attgactttgcagcaaagaatggactcgatcaagtattggttgaaggctggaatatcggc
tgggaagactggtttggacactctaaattcaaggtatttgatttccaaactccttatcca
gactttgacataaaggaactaaacgaatacgcacactctaaaggaattaagcttataatg
caccatgaaacatcttcttctatgataaattatgagcgttatatggaagatgcttataaa
ttgatgaataaatatggatataatgcggttaaaagtggttatgtaggcgatatcattcca
cgtggagaacaccactatggacaagttatgaataaccattatttatatgctgttaccgaa
gctgctaagcataagattatggttaacgctcacgaagcaacacgaccaacaggactttgc
cgtacatatcctaaccttataggtaacgaaagtgcacgaggtactgaatatgaagcattc
ggtggaagcaatcccgaccacactgttatattgccattcacacgtcttcaaggtggacca
atggactatacacctggtatttttgaaactaaattgaaagattggagcgacaataactct
tacgttcactctacattagcaggtcaattagctctttatcttgttatgtatagcccactt
caaatggctgcagaccttcccgaacactacgaaaaatatagcgacgctttccaattcatt
agagatgttgctgtagattgggacgattctaaatatattgaagctgaaccaggcgactat
atcactgttgctcgtaaagcaaaaggcacaaacaactggtttattggcggtaaatgtgac
gaaaatggacataaggctgttattaaacttgatttcttagacaaaggaaaaacatacgaa
tgcaccatatatagcgatgctcctaatgctgattacgacaaaaatccaaaggcatatacc
atcactcgcaaacatgtaaaatacggagatgtattgaaaatcaatgaagctccaggtgga
ggatttggtgtttcgctcttccctaaaaaataa

DBGET integrated database retrieval system