KEGG   Pseudomonas stutzeri RCH2: Psest_1949
Entry
Psest_1949        CDS       T02391                                 

Definition
(GenBank) putative N6-adenine-specific DNA methylase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
psh  Pseudomonas stutzeri RCH2
Brite
KEGG Orthology (KO) [BR:psh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:psh03009]
    Psest_1949
Enzymes [BR:psh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     Psest_1949
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     Psest_1949
Ribosome biogenesis [BR:psh03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Psest_1949
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 THUMP Methyltransf_25 MTS Methyltransf_24 Methyltransf_15 Methyltransf_11
Other DBs
NCBI-ProteinID: AGA86493
UniProt: L0GIE3
LinkDB
Position
2065390..2067570
AA seq 726 aa
MTDRHELILTCPKGLEGLLLEEATALGLEEAREQTSAIRGFGALEIAYRLCLWSRLANRV
LLVISRFPTVDAETLYQGVHAVDWADHLQPAGSLAVEFSGRGSGIDNTHFGALKVKDAIV
DRLRTASGERPSIDKLDPDLRVHLRLDKGQAVLSLDLSGHSLHQRGYRLQQGAAPLKENL
AAAILIRAGWPRIAAAGGALTDPMCGVGTFLVEGAMMAADIAPNLKRERWGFSAWLGHVP
AIWTRLHAEAVARAETGLAKPPLWIRGYEADPRLIQPGRNNIERAGLASWIKVYQGDVGD
FEPRPDQNQKGLVICNPPYGERLGDEASLLYLYQNLGERLRQACLGWEAAVFTAAPDLGK
RMGIRSHKQYAFWNGALPCKLLLIKVELDQFVTGQRGAASEESTQQQAPVEQARLSEGGQ
MFANRLQKNLRQLGKWARREGIECYRLYDADMPEYALAIDLYRDWVHVQEYAPPRSIDPD
KAQARLLDALAAIPQALGIAREKVVVKRRERQSGTRQYERQATQGEFLEVAEGGVKLLVN
LTDYLDTGLFLDHRPLRLRIQREAAGKRFLNLFCYTATATVHAAKGGARSTTSVDLSKTY
LDWARRNLALNGLSDRQRLEQGDVMAWLEEDRGEYDLIFIDPPTFSNSKRMEGVFDVQRD
HLALLDLAMARLAAGGTLYFSNNFRKFVLDAGLSDRYAVEEITASTLDEDFRRNPRIHRA
WKLQAR
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgaccgaccgccatgaactgatcctgacctgccccaaagggctcgaaggtctgctgctc
gaggaagccaccgcactcggactggaagaagcccgcgagcagacatctgctattcgtgga
ttcggtgcgctggagatcgcttatcggctctgcctgtggtcgcgactggccaaccgcgtg
ttgttggtgatcagccgttttcctacggttgatgccgagacgctctaccagggtgttcac
gccgtcgactgggcggaccatctgcagcctgccggcagcctggcggtggagttcagtggt
cgcggatccggcatcgacaacacccatttcggcgcgctcaaggtcaaggatgccatcgtt
gatcgcctgcgcaccgcatcgggcgaacggcctagcatcgacaagcttgaccctgacttg
cgcgtgcatctacgcctcgacaaggggcaggcggtcctttccctggacctctccgggcac
agcctgcatcagcgcggctatcgcctgcagcagggcgccgcgccgttgaaggaaaacctt
gctgccgcgattctgatccgcgcgggctggccgcgtatcgctgctgctggcggtgcgttg
actgaccccatgtgcggcgtcggtaccttcctcgtagaaggagcaatgatggcggcggac
atcgcaccgaatctcaagcgcgaacgctggggattcagcgcctggctcggtcacgtacca
gcgatctggacccgcctgcacgctgaagcagtggcgcgcgcggagaccggattggccaag
cccccgctgtggatccgcggctatgaggccgacccgcgattgatccagccagggcgcaac
aacatcgagcgtgccggtctggccagctggatcaaggtttatcagggcgatgtcggcgat
ttcgaaccgcgcccggaccagaatcagaagggcctggtcatttgcaacccaccatacggc
gaacgcctgggtgacgaggcgagcctgctttatctctaccagaatcttggcgagcgtttg
cgccaggcgtgccttggctgggaagctgctgtattcaccgctgcgccggacctcggcaag
cgcatgggcattcgcagccacaaacagtacgcattctggaacggcgcactgccgtgcaag
ctgctgctcataaaggtcgaactggaccagttcgttaccggtcagcgcggcgccgcaagc
gaggaaagtacgcagcaacaggcaccggtcgagcaggcgcgcctcagcgaaggcgggcag
atgtttgccaatcgcttgcagaagaacctgcgtcagcttggcaaatgggcgcgtcgggag
ggcatcgagtgttatcggctgtatgacgccgatatgccggagtacgcgctggcaatcgac
ctctaccgtgactgggtgcatgtgcaggagtatgcgccaccccgttcaatcgacccggat
aaggcccaggctcggctactcgatgcgttggcggccattccacaggccttggggattgcg
cgggaaaaggtggtggtcaagcgccgggaacggcagtccggcacgcgccagtacgagcgt
caggccactcagggcgagtttcttgaggtagccgaaggcggcgtcaagctactggtcaat
ctcaccgactatctcgataccgggttgtttctcgaccatcgcccgctgcgcctgcgtatt
cagcgcgaggcggccggaaaacgctttctcaacctgttctgctataccgctaccgcaacg
gtgcacgccgcgaagggtggggcgcggagcaccaccagcgtcgatctgtcgaaaacctat
cttgactgggcgcgacgtaaccttgcgctgaatgggctttcggatcggcagcgactggag
cagggggatgtaatggcatggctggaggaggatcgtggcgaatacgatctgatcttcatc
gacccgccgaccttctccaattcaaaacggatggaaggggtgttcgacgttcagcgcgat
catcttgcgttgctcgatctggccatggcgcggctggcggcgggcggtaccctgtacttc
tccaacaacttccgcaagttcgtgctcgacgcaggtctgagtgatcgttatgcggtggag
gaaatcaccgcctcgacgctggatgaagacttccgtcgcaatccgcgaatccaccgcgcc
tggaagctgcaggcacggtga

DBGET integrated database retrieval system