KEGG   Papaver somniferum (opium poppy): 113330131Help
Entry
113330131         CDS       T05758                                 

Definition
(RefSeq) ent-kaurene oxidase, chloroplastic-like
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00904  Diterpenoid biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    113330131
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:psom00199]
    113330131
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     113330131
Cytochrome P450 [BR:psom00199]
 Cytochrome P450, plant type
  CYP701 family
   113330131
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 SIX1_SD
Motif
Other DBs
NCBI-GeneID: 113330131
NCBI-ProteinID: XP_026432771
LinkDB All DBs
Position
Unknown
AA seq 477 aa AA seqDB search
MSSRKIYCCREISAAVPGLPLIGNLLQLKDKIFHQTFANWEEIYGPIYSIKIGASTIVVL
NNTDVVQEAIVTKFSSISKRKLTHAMKILGTDILIASDSNEYHKMARRLVVTHMLGAGAQ
RRHRAHRDIMMDNIVRCLQAHAKENPLKPVNFRKILQTEIFGLILKQALGKDVGSSKYIE
GLGETLSRDEILKVLVLEPLSGGIEMDWRDFFPYMRWVPNKNFEKHIGRMETRRLEVMKT
LIEEQQKRISSGEGINCYLDWLMSEGKTLTKTQVSILIWETIFVGTDSSVQTAEWAMYEL
AKNPKYQDQLHHEIQKVCGNGKYTEEQYSGVTYLGAVFHETLRKYPPSLIALPLKYVHED
TQLGGYDIPAGTEIAINIYGCNMDKNQWDSPKEWKPERFQDSKHDPKDLYKTMSFGGGKR
VCPGALQGLLITSTAIARCIQEFKWSLELAESEEEDINTTTLTTQIPNPFLATPRNC
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccagaaaaatatattgttgtcgtgaaatatctgcagcggttccagggttgcca
ttgataggaaatctactgcagctaaaagataagatatttcatcagacttttgcaaactgg
gaagaaatctatggacccatttactccattaaaataggagcttctactattgttgtcctc
aataacaccgatgttgtccaagaggcaatagtaactaaattctcatccatttcaaagagg
aagcttactcacgcgatgaaaatacttggaactgatattctcatagcaagtgattctaat
gaatatcataagatggcaagacgacttgtagtcactcacatgctgggagctggtgctcag
aggcgacatcgtgcacacagagacatcatgatggataacatagtgcgttgcttacaagcc
catgccaaggaaaatcctctcaaaccagtaaacttcaggaagatactccaaactgaaatc
tttggtctaattttgaaacaagcattaggaaaagatgtaggatcttcaaaatatattgaa
ggtcttggtgaaactttgtcaagagatgagatcttaaaggttttagtgttggagccacta
tcgggaggaattgaaatggactggagagactttttcccgtatatgagatgggttcctaat
aaaaactttgagaaacacattggacggatggagacacgcaggctagaagtgatgaaaact
cttattgaggagcaacagaaacggatttcatcgggagagggaataaattgttacctggat
tggttgatgtcggaagggaaaactcttacaaagacacaagtgagcatcttgatttgggag
accatttttgtgggtaccgattcaagtgtacaaaccgcagaatgggccatgtatgaactt
gcaaaaaacccaaaatatcaggatcaattacaccatgaaatacaaaaggtatgcggaaac
ggcaaatatacagaggagcagtattcaggggttacgtacttaggcgccgtttttcatgaa
acattgagaaagtatcccccttcactaatagcccttccacttaaatatgtacatgaagat
actcaactaggagggtatgacattcctgctggaacagagattgccatcaacatctatggt
tgcaatatggacaagaaccaatgggattcacccaaagaatggaaacccgagagatttcaa
gatagtaagcatgatcccaaggatctttacaagactatgtcatttggaggaggaaagagg
gtctgtccaggagctttgcaaggacttctgattactagcactgctattgccaggtgtatt
caagagttcaagtggagtttggaactagccgaatcggaggaagaagatataaatactact
accctcacaactcaaatccccaatccttttctagcaactccaagaaattgttga

DBGET integrated database retrieval system