KEGG   Panthera tigris altaica (Amur tiger): 102949853
Entry
102949853         CDS       T02988                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04070  Phosphatidylinositol signaling system
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04140  Autophagy - animal
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04152  AMPK signaling pathway
ptg04210  Apoptosis
ptg04211  Longevity regulating pathway
ptg04213  Longevity regulating pathway - multiple species
ptg04218  Cellular senescence
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04620  Toll-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04666  Fc gamma R-mediated phagocytosis
ptg04668  TNF signaling pathway
ptg04670  Leukocyte transendothelial migration
ptg04722  Neurotrophin signaling pathway
ptg04725  Cholinergic synapse
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04810  Regulation of actin cytoskeleton
ptg04910  Insulin signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04915  Estrogen signaling pathway
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04923  Regulation of lipolysis in adipocytes
ptg04926  Relaxin signaling pathway
ptg04929  GnRH secretion
ptg04930  Type II diabetes mellitus
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg04960  Aldosterone-regulated sodium reabsorption
ptg04973  Carbohydrate digestion and absorption
ptg05010  Alzheimer disease
ptg05017  Spinocerebellar ataxia
ptg05020  Prion disease
ptg05100  Bacterial invasion of epithelial cells
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05146  Amoebiasis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05218  Melanoma
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102949853 (PIK3R3)
   04014 Ras signaling pathway
    102949853 (PIK3R3)
   04015 Rap1 signaling pathway
    102949853 (PIK3R3)
   04370 VEGF signaling pathway
    102949853 (PIK3R3)
   04630 JAK-STAT signaling pathway
    102949853 (PIK3R3)
   04668 TNF signaling pathway
    102949853 (PIK3R3)
   04066 HIF-1 signaling pathway
    102949853 (PIK3R3)
   04068 FoxO signaling pathway
    102949853 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    102949853 (PIK3R3)
   04072 Phospholipase D signaling pathway
    102949853 (PIK3R3)
   04071 Sphingolipid signaling pathway
    102949853 (PIK3R3)
   04024 cAMP signaling pathway
    102949853 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    102949853 (PIK3R3)
   04152 AMPK signaling pathway
    102949853 (PIK3R3)
   04150 mTOR signaling pathway
    102949853 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102949853 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    102949853 (PIK3R3)
   04218 Cellular senescence
    102949853 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102949853 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102949853 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102949853 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102949853 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    102949853 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    102949853 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    102949853 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    102949853 (PIK3R3)
   04660 T cell receptor signaling pathway
    102949853 (PIK3R3)
   04662 B cell receptor signaling pathway
    102949853 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    102949853 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    102949853 (PIK3R3)
   04670 Leukocyte transendothelial migration
    102949853 (PIK3R3)
   04062 Chemokine signaling pathway
    102949853 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102949853 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    102949853 (PIK3R3)
   04929 GnRH secretion
    102949853 (PIK3R3)
   04915 Estrogen signaling pathway
    102949853 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    102949853 (PIK3R3)
   04917 Prolactin signaling pathway
    102949853 (PIK3R3)
   04926 Relaxin signaling pathway
    102949853 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    102949853 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    102949853 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102949853 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102949853 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    102949853 (PIK3R3)
   04722 Neurotrophin signaling pathway
    102949853 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102949853 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    102949853 (PIK3R3)
   04380 Osteoclast differentiation
    102949853 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    102949853 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    102949853 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102949853 (PIK3R3)
   05206 MicroRNAs in cancer
    102949853 (PIK3R3)
   05205 Proteoglycans in cancer
    102949853 (PIK3R3)
   05203 Viral carcinogenesis
    102949853 (PIK3R3)
   05230 Central carbon metabolism in cancer
    102949853 (PIK3R3)
   05231 Choline metabolism in cancer
    102949853 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102949853 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102949853 (PIK3R3)
   05212 Pancreatic cancer
    102949853 (PIK3R3)
   05225 Hepatocellular carcinoma
    102949853 (PIK3R3)
   05226 Gastric cancer
    102949853 (PIK3R3)
   05214 Glioma
    102949853 (PIK3R3)
   05221 Acute myeloid leukemia
    102949853 (PIK3R3)
   05220 Chronic myeloid leukemia
    102949853 (PIK3R3)
   05218 Melanoma
    102949853 (PIK3R3)
   05211 Renal cell carcinoma
    102949853 (PIK3R3)
   05215 Prostate cancer
    102949853 (PIK3R3)
   05213 Endometrial cancer
    102949853 (PIK3R3)
   05224 Breast cancer
    102949853 (PIK3R3)
   05222 Small cell lung cancer
    102949853 (PIK3R3)
   05223 Non-small cell lung cancer
    102949853 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102949853 (PIK3R3)
   05017 Spinocerebellar ataxia
    102949853 (PIK3R3)
   05020 Prion disease
    102949853 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102949853 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102949853 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    102949853 (PIK3R3)
   04931 Insulin resistance
    102949853 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102949853 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102949853 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    102949853 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102949853 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    102949853 (PIK3R3)
   05161 Hepatitis B
    102949853 (PIK3R3)
   05160 Hepatitis C
    102949853 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    102949853 (PIK3R3)
   05164 Influenza A
    102949853 (PIK3R3)
   05162 Measles
    102949853 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    102949853 (PIK3R3)
   05163 Human cytomegalovirus infection
    102949853 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102949853 (PIK3R3)
   05169 Epstein-Barr virus infection
    102949853 (PIK3R3)
   05165 Human papillomavirus infection
    102949853 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102949853 (PIK3R3)
   05142 Chagas disease
    102949853 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102949853 (PIK3R3)
   01524 Platinum drug resistance
    102949853 (PIK3R3)
   01522 Endocrine resistance
    102949853 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102949853 (PIK3R3)
Membrane trafficking [BR:ptg04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102949853 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 DUF5638 PI_PP_I
Other DBs
NCBI-GeneID: 102949853
NCBI-ProteinID: XP_007077324
LinkDB
Position
Un
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSFCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagctgttacaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattacgg
gatatgccagatggtacgttcttggtcagagatgcctcaacaaaaatgcagggagattac
actttgactttgcggaagggaggcaataataagttaataaagatctatcatcgagatggt
aaatacggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactat
catcatgaatctcttgctcagtacaatcccaaacttgatgtgaagctcatgtaccccgtg
tccagataccaacaggatcaattggtaaaagaagataacattgatgcagtaggtaaaaaa
ctccaagagtaccactctcagtatcaggaaaagagtaaggagtatgacaggctatatgag
gaatataccagaacatcacaggaaatacagatgaaaaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcacacacaagaacagcatagcaaagaatat
atcgagcgatttcgcagagaggggaatgaaaaggaaattgaacgaattatgatgaattat
gacaaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaagat
ttgaagaaacaagctttggacaaccgagaaatagataaaaaaatgaacagtatcaaacct
gacctgatccagctgcgcaagatccgagatcagcaccttgtatggctcaatcacaaagga
gtcagacagaaacgcctaaatgcctggctgggaatcaagaatgaagatgctgatgagacc
tattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattc
ttaattcgtgagagtagcaagaaaggatgttatgcttgctctgtggttgccgatggggaa
gtgaagcactgtgtgatctacagtactgctcggggctatggcttcgcagagccctacaac
ctgtacagctcgctgaaggagctggtgctccattaccagcagacgtcccttgttcaacac
aacgactccctcaatgtccggcttgcctaccctgtccatgcacagatgccctcgttctgc
agataa

KEGG   Panthera tigris altaica (Amur tiger): 102952993
Entry
102952993         CDS       T02988                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04070  Phosphatidylinositol signaling system
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04140  Autophagy - animal
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04152  AMPK signaling pathway
ptg04210  Apoptosis
ptg04211  Longevity regulating pathway
ptg04213  Longevity regulating pathway - multiple species
ptg04218  Cellular senescence
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04620  Toll-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04666  Fc gamma R-mediated phagocytosis
ptg04668  TNF signaling pathway
ptg04670  Leukocyte transendothelial migration
ptg04722  Neurotrophin signaling pathway
ptg04725  Cholinergic synapse
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04810  Regulation of actin cytoskeleton
ptg04910  Insulin signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04915  Estrogen signaling pathway
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04923  Regulation of lipolysis in adipocytes
ptg04926  Relaxin signaling pathway
ptg04929  GnRH secretion
ptg04930  Type II diabetes mellitus
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg04960  Aldosterone-regulated sodium reabsorption
ptg04973  Carbohydrate digestion and absorption
ptg05010  Alzheimer disease
ptg05017  Spinocerebellar ataxia
ptg05020  Prion disease
ptg05100  Bacterial invasion of epithelial cells
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05146  Amoebiasis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05218  Melanoma
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102952993 (PIK3R1)
   04014 Ras signaling pathway
    102952993 (PIK3R1)
   04015 Rap1 signaling pathway
    102952993 (PIK3R1)
   04370 VEGF signaling pathway
    102952993 (PIK3R1)
   04630 JAK-STAT signaling pathway
    102952993 (PIK3R1)
   04668 TNF signaling pathway
    102952993 (PIK3R1)
   04066 HIF-1 signaling pathway
    102952993 (PIK3R1)
   04068 FoxO signaling pathway
    102952993 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    102952993 (PIK3R1)
   04072 Phospholipase D signaling pathway
    102952993 (PIK3R1)
   04071 Sphingolipid signaling pathway
    102952993 (PIK3R1)
   04024 cAMP signaling pathway
    102952993 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    102952993 (PIK3R1)
   04152 AMPK signaling pathway
    102952993 (PIK3R1)
   04150 mTOR signaling pathway
    102952993 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102952993 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    102952993 (PIK3R1)
   04218 Cellular senescence
    102952993 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102952993 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102952993 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102952993 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102952993 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    102952993 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    102952993 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    102952993 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    102952993 (PIK3R1)
   04660 T cell receptor signaling pathway
    102952993 (PIK3R1)
   04662 B cell receptor signaling pathway
    102952993 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    102952993 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    102952993 (PIK3R1)
   04670 Leukocyte transendothelial migration
    102952993 (PIK3R1)
   04062 Chemokine signaling pathway
    102952993 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102952993 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    102952993 (PIK3R1)
   04929 GnRH secretion
    102952993 (PIK3R1)
   04915 Estrogen signaling pathway
    102952993 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    102952993 (PIK3R1)
   04917 Prolactin signaling pathway
    102952993 (PIK3R1)
   04926 Relaxin signaling pathway
    102952993 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    102952993 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    102952993 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102952993 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102952993 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    102952993 (PIK3R1)
   04722 Neurotrophin signaling pathway
    102952993 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102952993 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    102952993 (PIK3R1)
   04380 Osteoclast differentiation
    102952993 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    102952993 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    102952993 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102952993 (PIK3R1)
   05206 MicroRNAs in cancer
    102952993 (PIK3R1)
   05205 Proteoglycans in cancer
    102952993 (PIK3R1)
   05203 Viral carcinogenesis
    102952993 (PIK3R1)
   05230 Central carbon metabolism in cancer
    102952993 (PIK3R1)
   05231 Choline metabolism in cancer
    102952993 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102952993 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102952993 (PIK3R1)
   05212 Pancreatic cancer
    102952993 (PIK3R1)
   05225 Hepatocellular carcinoma
    102952993 (PIK3R1)
   05226 Gastric cancer
    102952993 (PIK3R1)
   05214 Glioma
    102952993 (PIK3R1)
   05221 Acute myeloid leukemia
    102952993 (PIK3R1)
   05220 Chronic myeloid leukemia
    102952993 (PIK3R1)
   05218 Melanoma
    102952993 (PIK3R1)
   05211 Renal cell carcinoma
    102952993 (PIK3R1)
   05215 Prostate cancer
    102952993 (PIK3R1)
   05213 Endometrial cancer
    102952993 (PIK3R1)
   05224 Breast cancer
    102952993 (PIK3R1)
   05222 Small cell lung cancer
    102952993 (PIK3R1)
   05223 Non-small cell lung cancer
    102952993 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102952993 (PIK3R1)
   05017 Spinocerebellar ataxia
    102952993 (PIK3R1)
   05020 Prion disease
    102952993 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102952993 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102952993 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    102952993 (PIK3R1)
   04931 Insulin resistance
    102952993 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102952993 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102952993 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    102952993 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102952993 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    102952993 (PIK3R1)
   05161 Hepatitis B
    102952993 (PIK3R1)
   05160 Hepatitis C
    102952993 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    102952993 (PIK3R1)
   05164 Influenza A
    102952993 (PIK3R1)
   05162 Measles
    102952993 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    102952993 (PIK3R1)
   05163 Human cytomegalovirus infection
    102952993 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102952993 (PIK3R1)
   05169 Epstein-Barr virus infection
    102952993 (PIK3R1)
   05165 Human papillomavirus infection
    102952993 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102952993 (PIK3R1)
   05142 Chagas disease
    102952993 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102952993 (PIK3R1)
   01524 Platinum drug resistance
    102952993 (PIK3R1)
   01522 Endocrine resistance
    102952993 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102952993 (PIK3R1)
Membrane trafficking [BR:ptg04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102952993 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 DUF4201 AAA_13 Lant_dehydr_C PI_PP_I Laminin_I
Other DBs
NCBI-GeneID: 102952993
NCBI-ProteinID: XP_007079946
LinkDB
Position
Un
AA seq 726 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDVLTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKAEADSEQQQALALPDLA
EQFAPPDIAPPLLVKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMIDV
QVLGDAFKRYLTDLPNPVIPVAVYNEMLYLAQEVQSPEEYIQLLKKLIRAPNIPHQYWLT
LQYLLKHFFKLSQISSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKVIEILISTEWN
ERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRD
ASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPK
LDVKLLYPVSKYQQDQVVKEDNIEAVGXKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQ
MKRTAIEAFNETIKIFEEQCQSQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEI
VDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWL
GNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYA
CSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV
YAQQRR
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgagtgccgagggctaccagtaccgggcgctgtatgattacaaaaaggaacgagaagaa
gatattgacttgcacttgggcgatgtattgactgtgaataaagggtctttagtagctctt
ggattcagtgacggacaggaagccaggcctgaagaaattggctggttaaatggttataat
gaaaccacgggggaaagaggggactttccaggaacttacgttgaatatattggaaggaaa
aaaatctcgcctcccacaccaaagccccgaccacctcgaccccttcctgttgcaccaggt
tcttcaaaagctgaagcagacagtgagcaacaacaagctttggctctgccagatcttgcg
gagcagtttgcccctcctgacatcgctccgcctcttcttgtgaagctagtggaagccatt
gaaaagaaaggtctggaatgttcaactttatacagaacacagagctccagcaacccagca
gaattacgacagcttcttgattgtgatgccgcctccgtggacttggaaatgatcgatgtg
caagttttaggagacgctttcaaacgctatcttacggacttaccgaatcctgtcattcca
gtagccgtttacaatgagatgctttatttagcccaagaagtacaaagccctgaagaatat
atccagctgttgaagaagctcattagggcacctaacatacctcatcagtattggcttacg
cttcagtatttgctaaaacatttcttcaagctctctcaaatctccagcaagaatcttctg
aatgcaagagtactctctgaacttttcagccctctgcttttcagattcccagcagccagc
tctgagaatactgaacacctcataaaagttatagaaattttaatctcgaccgagtggaat
gaacgacagcctgcaccagcattgcctcctaaaccacccaaacccactactgtagccaac
aacggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctca
agggaagaagtgaatgaaaaacttcgagatacagctgatgggacctttttggtacgagat
gcatctactaaaatgcacggtgattatactcttacactaaggaaaggaggaaataacaag
ttaatcaaaatatttcaccgagatgggaaatatggcttctctgacccactaaccttcaac
tctgtggttgaactaataaaccactaccggaatgagtccctagctcagtataatcccaaa
ctggacgtgaaattactttatccagtatccaaataccaacaggatcaagttgtcaaagaa
gataatattgaagctgtagggaanaaaaaattacatgaatataacactcaatttcaagaa
aaaagtcgggaatatgatagattatatgaagattatacccgtacttcccaggaaatccag
atgaaaagaacagctattgaagcatttaatgaaaccataaaaatatttgaagagcagtgc
caaagccaagaacggtacagcaaagaatacatagaaaaatttaaacgggaaggcaatgag
aaagaaatacaaaggattatgcataattatgaaaagttgaagtctcgcatcagtgaaatt
gtggacagtagaagacgactggaggaggacttgaagaaacaggcagctgagtatcgggag
attgacaagcgcatgaacagcattaaaccagacctcattcagctgagaaagacaagagac
caatacttgatgtggttgactcagaaaggtgttcggcagaagaagctgaacgagtggctg
ggcaatgagaacactgaagaccaatactcgctggtggaggatgatgaggatttgccgcac
cacgacgagaagacatggaatgtcggcagcagcaacagaaacaaggctgaaaacctactc
cgggggaagcgagatggcaccttcctggtccgggaaagcagtaaacagggctgctatgcc
tgctcggtagtggtggatggcgaagtgaagcactgtgtcatcaacaaaacggcaactggc
tacggctttgccgagccctataacctgtacagctccctcaaagagctggtgctacattac
caacacacctccctcgtgcagcacaacgactccctcaacgtcacactagcctacccggta
tatgcacagcagaggcgatga

KEGG   Panthera tigris altaica (Amur tiger): 102953082
Entry
102953082         CDS       T02988                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00562  Inositol phosphate metabolism
ptg01100  Metabolic pathways
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04070  Phosphatidylinositol signaling system
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04140  Autophagy - animal
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04152  AMPK signaling pathway
ptg04210  Apoptosis
ptg04211  Longevity regulating pathway
ptg04213  Longevity regulating pathway - multiple species
ptg04218  Cellular senescence
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04620  Toll-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04666  Fc gamma R-mediated phagocytosis
ptg04668  TNF signaling pathway
ptg04670  Leukocyte transendothelial migration
ptg04722  Neurotrophin signaling pathway
ptg04725  Cholinergic synapse
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04810  Regulation of actin cytoskeleton
ptg04910  Insulin signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04915  Estrogen signaling pathway
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04923  Regulation of lipolysis in adipocytes
ptg04926  Relaxin signaling pathway
ptg04929  GnRH secretion
ptg04930  Type II diabetes mellitus
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg04960  Aldosterone-regulated sodium reabsorption
ptg04973  Carbohydrate digestion and absorption
ptg05010  Alzheimer disease
ptg05017  Spinocerebellar ataxia
ptg05020  Prion disease
ptg05100  Bacterial invasion of epithelial cells
ptg05132  Salmonella infection
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05146  Amoebiasis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05218  Melanoma
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102953082 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102953082 (PIK3CD)
   04014 Ras signaling pathway
    102953082 (PIK3CD)
   04015 Rap1 signaling pathway
    102953082 (PIK3CD)
   04370 VEGF signaling pathway
    102953082 (PIK3CD)
   04630 JAK-STAT signaling pathway
    102953082 (PIK3CD)
   04668 TNF signaling pathway
    102953082 (PIK3CD)
   04066 HIF-1 signaling pathway
    102953082 (PIK3CD)
   04068 FoxO signaling pathway
    102953082 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    102953082 (PIK3CD)
   04072 Phospholipase D signaling pathway
    102953082 (PIK3CD)
   04071 Sphingolipid signaling pathway
    102953082 (PIK3CD)
   04024 cAMP signaling pathway
    102953082 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    102953082 (PIK3CD)
   04152 AMPK signaling pathway
    102953082 (PIK3CD)
   04150 mTOR signaling pathway
    102953082 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102953082 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    102953082 (PIK3CD)
   04218 Cellular senescence
    102953082 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102953082 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    102953082 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102953082 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102953082 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    102953082 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    102953082 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    102953082 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    102953082 (PIK3CD)
   04660 T cell receptor signaling pathway
    102953082 (PIK3CD)
   04662 B cell receptor signaling pathway
    102953082 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    102953082 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    102953082 (PIK3CD)
   04670 Leukocyte transendothelial migration
    102953082 (PIK3CD)
   04062 Chemokine signaling pathway
    102953082 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102953082 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    102953082 (PIK3CD)
   04929 GnRH secretion
    102953082 (PIK3CD)
   04915 Estrogen signaling pathway
    102953082 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    102953082 (PIK3CD)
   04917 Prolactin signaling pathway
    102953082 (PIK3CD)
   04926 Relaxin signaling pathway
    102953082 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    102953082 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    102953082 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102953082 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102953082 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    102953082 (PIK3CD)
   04722 Neurotrophin signaling pathway
    102953082 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102953082 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    102953082 (PIK3CD)
   04380 Osteoclast differentiation
    102953082 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    102953082 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    102953082 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102953082 (PIK3CD)
   05206 MicroRNAs in cancer
    102953082 (PIK3CD)
   05205 Proteoglycans in cancer
    102953082 (PIK3CD)
   05203 Viral carcinogenesis
    102953082 (PIK3CD)
   05230 Central carbon metabolism in cancer
    102953082 (PIK3CD)
   05231 Choline metabolism in cancer
    102953082 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102953082 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102953082 (PIK3CD)
   05212 Pancreatic cancer
    102953082 (PIK3CD)
   05225 Hepatocellular carcinoma
    102953082 (PIK3CD)
   05226 Gastric cancer
    102953082 (PIK3CD)
   05214 Glioma
    102953082 (PIK3CD)
   05221 Acute myeloid leukemia
    102953082 (PIK3CD)
   05220 Chronic myeloid leukemia
    102953082 (PIK3CD)
   05218 Melanoma
    102953082 (PIK3CD)
   05211 Renal cell carcinoma
    102953082 (PIK3CD)
   05215 Prostate cancer
    102953082 (PIK3CD)
   05213 Endometrial cancer
    102953082 (PIK3CD)
   05224 Breast cancer
    102953082 (PIK3CD)
   05222 Small cell lung cancer
    102953082 (PIK3CD)
   05223 Non-small cell lung cancer
    102953082 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102953082 (PIK3CD)
   05017 Spinocerebellar ataxia
    102953082 (PIK3CD)
   05020 Prion disease
    102953082 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102953082 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102953082 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    102953082 (PIK3CD)
   04931 Insulin resistance
    102953082 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102953082 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102953082 (PIK3CD)
   05135 Yersinia infection
    102953082 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    102953082 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102953082 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    102953082 (PIK3CD)
   05161 Hepatitis B
    102953082 (PIK3CD)
   05160 Hepatitis C
    102953082 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    102953082 (PIK3CD)
   05164 Influenza A
    102953082 (PIK3CD)
   05162 Measles
    102953082 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    102953082 (PIK3CD)
   05163 Human cytomegalovirus infection
    102953082 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102953082 (PIK3CD)
   05169 Epstein-Barr virus infection
    102953082 (PIK3CD)
   05165 Human papillomavirus infection
    102953082 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102953082 (PIK3CD)
   05142 Chagas disease
    102953082 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102953082 (PIK3CD)
   01524 Platinum drug resistance
    102953082 (PIK3CD)
   01522 Endocrine resistance
    102953082 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102953082 (PIK3CD)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102953082 (PIK3CD)
Membrane trafficking [BR:ptg04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102953082 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3K_p85B PI3K_C2 PI3K_rbd DUF4135
Other DBs
NCBI-GeneID: 102953082
NCBI-ProteinID: XP_015391316
LinkDB
Position
Un
AA seq 693 aa
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLVNSQISLL
IGKGSRPNVPPGKSDERQNDQMALVTGPLIRSINISWVSATCLHQTLPSWSWCWGEGAPI
TNRQPHPLCPRVHAPPPLRPPXXXXXXXXXXXXPPQESFTFQVSSKDVPLALMACALRKK
ATVFRQPLLERPEDYTLQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHPTLASSFPSSL
SLWSLEQPFCVELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSSSEVSVCSEPVWKQR
LEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKT
GECCLYMWPSAPDEKGELRLGVGSPPEARAFPSGDGRADLRQDMLTLQMIQLMDVLWKQE
GLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNP
GEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRENGQLFHIDFGHFLGNFKTKFG
INRERVPFILTYDFVHVIQQGKTNNSEKFERAAGLPELSCSKDIQYLKDSLALGKTEEEA
LKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagagtgtg
gcagttgacttcctgctgcccacgggagtctatctgaacttccctgtgtcccggaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgcgcccagtatgagccactcttccac
atgctcagcgaccctgaggcctacgtgttcacctgcgtcaaccagaccgcggagcagcag
gagctggaggacgagcagcggcgactgtgtgacatccagcccttcctgccggtgctgcgc
ctggtggcccgagagggtgacagggtgaagaagctcgtcaactcacagatcagcctcctc
atcggcaaaggatctcggccaaatgtcccacccggcaagtcggatgagaggcagaatgac
caaatggccttggtcactggcccactcattcgttcaataaatatttcttgggtgtcggcc
acgtgcctgcatcagactctgccctcgtggagctggtgctggggggagggggcacctatt
acaaataggcaaccccaccctctgtgtcccagagtccatgcgccaccccccctccgcccc
ccannnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncccccccaggagagcttcacc
ttccaggtgtccagcaaggatgtgcccctggcactgatggcctgtgccctccggaagaag
gccacggtgttccggcagccgctgctggagcggcctgaggactacaccctgcaggtgaac
gggaagcacgagtacctgtacggcagctaccccctctgccagttccagtacatctgcagc
tgcttgcacagcgggctgaccccccacccgaccctggcgtcctcttttccttcttccttg
tccctgtggtccctggagcagcctttctgcgtggagctgatccagggtagcaaagtgaat
gcggatgagcggatgaagctggtggtgcaggccgggctcttccatggcaacgagacgctg
tgcaagacggtgtccagctcggaggtgagcgtgtgctcagagcccgtgtggaagcagcgg
ctagagtttgacatcaacgtctgcgacctgcctcgcatggctcgtctctgctttgcactt
tacgccgtgatcgagaaggccaagaaggctcggtccaccaagaagaagtccaagaaggcg
gactgccccatcgcctgggccaacctcatgctgtttgactacaaggaccagctcaagacc
ggggaatgctgcctgtacatgtggccgtccgcaccagacgagaagggggagctgcggctg
ggagtggggagcccaccagaagctcgtgcttttccttccggggacggccgcgcagacctc
cgccaggacatgctgactctgcagatgatccagctcatggacgttctgtggaagcaggag
ggattggacctgaggatgacgccctacggctgcctctccacgggggaccgcacaggcctc
atcgaggtggtgcttcactcagacaccatcgccaacatccagctgaacaaaagcaacatg
gccgccacggctgccttcaacaaggatgccctgctcaactggctcaagtccaagaaccct
ggggaagccttggatcgagccattgaggagtttaccctctcctgcgccggttactgtgtg
gccacttacgtgttgggcatcggtgatcggcacagtgacaacatcatgatccgcgagaat
gggcagctgttccacattgattttggccactttctggggaatttcaagaccaagtttgga
atcaaccgtgagcgcgtcccattcatcctcacgtacgactttgtgcacgtgatccagcag
gggaaaacgaataacagtgagaaatttgaaagggccgccggcctgcctgagctcagctgc
tccaaagacatccagtatctcaaggactctctggccttgggaaagacagaggaggaggct
ctaaagcacttccgagtgaagtttaacgaagccctccgggagagctggaagaccaaagtg
aactggctggcccacaacgtgtccaaagacaataggcagtag

KEGG   Panthera tigris altaica (Amur tiger): 102965070
Entry
102965070         CDS       T02988                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00562  Inositol phosphate metabolism
ptg01100  Metabolic pathways
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04070  Phosphatidylinositol signaling system
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04140  Autophagy - animal
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04152  AMPK signaling pathway
ptg04210  Apoptosis
ptg04211  Longevity regulating pathway
ptg04213  Longevity regulating pathway - multiple species
ptg04218  Cellular senescence
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04620  Toll-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04666  Fc gamma R-mediated phagocytosis
ptg04668  TNF signaling pathway
ptg04670  Leukocyte transendothelial migration
ptg04722  Neurotrophin signaling pathway
ptg04725  Cholinergic synapse
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04810  Regulation of actin cytoskeleton
ptg04910  Insulin signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04915  Estrogen signaling pathway
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04923  Regulation of lipolysis in adipocytes
ptg04926  Relaxin signaling pathway
ptg04929  GnRH secretion
ptg04930  Type II diabetes mellitus
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg04960  Aldosterone-regulated sodium reabsorption
ptg04973  Carbohydrate digestion and absorption
ptg05010  Alzheimer disease
ptg05017  Spinocerebellar ataxia
ptg05020  Prion disease
ptg05100  Bacterial invasion of epithelial cells
ptg05132  Salmonella infection
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05146  Amoebiasis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05218  Melanoma
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102965070 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102965070 (PIK3CA)
   04014 Ras signaling pathway
    102965070 (PIK3CA)
   04015 Rap1 signaling pathway
    102965070 (PIK3CA)
   04370 VEGF signaling pathway
    102965070 (PIK3CA)
   04630 JAK-STAT signaling pathway
    102965070 (PIK3CA)
   04668 TNF signaling pathway
    102965070 (PIK3CA)
   04066 HIF-1 signaling pathway
    102965070 (PIK3CA)
   04068 FoxO signaling pathway
    102965070 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    102965070 (PIK3CA)
   04072 Phospholipase D signaling pathway
    102965070 (PIK3CA)
   04071 Sphingolipid signaling pathway
    102965070 (PIK3CA)
   04024 cAMP signaling pathway
    102965070 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    102965070 (PIK3CA)
   04152 AMPK signaling pathway
    102965070 (PIK3CA)
   04150 mTOR signaling pathway
    102965070 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102965070 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    102965070 (PIK3CA)
   04218 Cellular senescence
    102965070 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102965070 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    102965070 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102965070 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102965070 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    102965070 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    102965070 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    102965070 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    102965070 (PIK3CA)
   04660 T cell receptor signaling pathway
    102965070 (PIK3CA)
   04662 B cell receptor signaling pathway
    102965070 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    102965070 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    102965070 (PIK3CA)
   04670 Leukocyte transendothelial migration
    102965070 (PIK3CA)
   04062 Chemokine signaling pathway
    102965070 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102965070 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    102965070 (PIK3CA)
   04929 GnRH secretion
    102965070 (PIK3CA)
   04915 Estrogen signaling pathway
    102965070 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    102965070 (PIK3CA)
   04917 Prolactin signaling pathway
    102965070 (PIK3CA)
   04926 Relaxin signaling pathway
    102965070 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    102965070 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    102965070 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102965070 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102965070 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    102965070 (PIK3CA)
   04722 Neurotrophin signaling pathway
    102965070 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102965070 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    102965070 (PIK3CA)
   04380 Osteoclast differentiation
    102965070 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    102965070 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    102965070 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102965070 (PIK3CA)
   05206 MicroRNAs in cancer
    102965070 (PIK3CA)
   05205 Proteoglycans in cancer
    102965070 (PIK3CA)
   05203 Viral carcinogenesis
    102965070 (PIK3CA)
   05230 Central carbon metabolism in cancer
    102965070 (PIK3CA)
   05231 Choline metabolism in cancer
    102965070 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102965070 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102965070 (PIK3CA)
   05212 Pancreatic cancer
    102965070 (PIK3CA)
   05225 Hepatocellular carcinoma
    102965070 (PIK3CA)
   05226 Gastric cancer
    102965070 (PIK3CA)
   05214 Glioma
    102965070 (PIK3CA)
   05221 Acute myeloid leukemia
    102965070 (PIK3CA)
   05220 Chronic myeloid leukemia
    102965070 (PIK3CA)
   05218 Melanoma
    102965070 (PIK3CA)
   05211 Renal cell carcinoma
    102965070 (PIK3CA)
   05215 Prostate cancer
    102965070 (PIK3CA)
   05213 Endometrial cancer
    102965070 (PIK3CA)
   05224 Breast cancer
    102965070 (PIK3CA)
   05222 Small cell lung cancer
    102965070 (PIK3CA)
   05223 Non-small cell lung cancer
    102965070 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102965070 (PIK3CA)
   05017 Spinocerebellar ataxia
    102965070 (PIK3CA)
   05020 Prion disease
    102965070 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102965070 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102965070 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    102965070 (PIK3CA)
   04931 Insulin resistance
    102965070 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102965070 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102965070 (PIK3CA)
   05135 Yersinia infection
    102965070 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    102965070 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102965070 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    102965070 (PIK3CA)
   05161 Hepatitis B
    102965070 (PIK3CA)
   05160 Hepatitis C
    102965070 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    102965070 (PIK3CA)
   05164 Influenza A
    102965070 (PIK3CA)
   05162 Measles
    102965070 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    102965070 (PIK3CA)
   05163 Human cytomegalovirus infection
    102965070 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102965070 (PIK3CA)
   05169 Epstein-Barr virus infection
    102965070 (PIK3CA)
   05165 Human papillomavirus infection
    102965070 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102965070 (PIK3CA)
   05142 Chagas disease
    102965070 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102965070 (PIK3CA)
   01524 Platinum drug resistance
    102965070 (PIK3CA)
   01522 Endocrine resistance
    102965070 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102965070 (PIK3CA)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102965070 (PIK3CA)
Membrane trafficking [BR:ptg04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102965070 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 102965070
NCBI-ProteinID: XP_007094649
LinkDB
Position
Un
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPEMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgacgttagaatgcctccgtgaggct
acattaataactataaagcatgaattatttaaagaagcaagaaaatatcctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgagccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttcgggatcttaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaactagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaataccagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttccttgaaaaatatcctctaagtcagtataagtacataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctttactcccaactgccaatggac
tgtttcacaatgccatcttattccagacgtatctccacagctacaccatatatgaatgga
gaaacatctacaaagtccctttgggttataaatagtgcactcagaataaaaatcctttgt
gcaacctatgtgaatgtaaatattcgagacatcgacaagatctatgttcgaacaggtatc
tatcatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttctaat
cccaggtggaatgaatggctaaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactgggtcaaatccaaataaagaaaccccatgcttagagttggagtttgactggttc
agcagtgtggtaaagtttccagaaatgtcagtgattgaagagcatgccaactggtctgtg
tctcgagaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aacgaattaagagaaaatgataaagaacagctccgagcaatttgtacccgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccctgaaattctacccaaactgcttctgtctgttaaatggaattctagagatgaagta
gctcagatgtactgcttagtaaaagattggcctccaatcaaacctgaacaggcaatggag
cttctggattgtaattacccagatcctatggttcgaggttttgctgttcgatgcttggaa
aaatacttaacagatgacaagctttctcagtacttaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcgtattgtcgtgcatgtgggatgtatttgaag
cacctaaataggcaagttgaagctatggaaaagctcattaacttaactgacattctcaaa
caagaaaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgcgg
agaccagatttcatggatgctctacagggttttctgtctcctctaaatcctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgttaacactgcagatcattcgcattatg
gaaaatatctggcaaaatcaaggccttgatcttcgaatgttaccttatggttgtctgtca
atcggtgactgtgtgggacttattgaggtggtgagaaattctcacactattatgcagatt
caatgcaaaggtggcctgaaaggcgcactgcagttcaacagccacacgctacaccagtgg
ctcaaagacaagaacaaaggcgaaatatacgatgcagccattgacctgttcacacgttca
tgtgctggatattgtgttgctaccttcatactgggaatcggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactatttcatatagattttggacactttttggatcat
aagaagaaaaaatttggttataaacgggaacgtgtgccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaattcgaaaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
ctcttctcaatgatgcttggctctggaatgccagaactgcaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgaacaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Panthera tigris altaica (Amur tiger): 102967709
Entry
102967709         CDS       T02988                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04070  Phosphatidylinositol signaling system
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04140  Autophagy - animal
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04152  AMPK signaling pathway
ptg04210  Apoptosis
ptg04211  Longevity regulating pathway
ptg04213  Longevity regulating pathway - multiple species
ptg04218  Cellular senescence
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04620  Toll-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04666  Fc gamma R-mediated phagocytosis
ptg04668  TNF signaling pathway
ptg04670  Leukocyte transendothelial migration
ptg04722  Neurotrophin signaling pathway
ptg04725  Cholinergic synapse
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04810  Regulation of actin cytoskeleton
ptg04910  Insulin signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04915  Estrogen signaling pathway
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04923  Regulation of lipolysis in adipocytes
ptg04926  Relaxin signaling pathway
ptg04929  GnRH secretion
ptg04930  Type II diabetes mellitus
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg04960  Aldosterone-regulated sodium reabsorption
ptg04973  Carbohydrate digestion and absorption
ptg05010  Alzheimer disease
ptg05017  Spinocerebellar ataxia
ptg05020  Prion disease
ptg05100  Bacterial invasion of epithelial cells
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05146  Amoebiasis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05218  Melanoma
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102967709 (PIK3R2)
   04014 Ras signaling pathway
    102967709 (PIK3R2)
   04015 Rap1 signaling pathway
    102967709 (PIK3R2)
   04370 VEGF signaling pathway
    102967709 (PIK3R2)
   04630 JAK-STAT signaling pathway
    102967709 (PIK3R2)
   04668 TNF signaling pathway
    102967709 (PIK3R2)
   04066 HIF-1 signaling pathway
    102967709 (PIK3R2)
   04068 FoxO signaling pathway
    102967709 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    102967709 (PIK3R2)
   04072 Phospholipase D signaling pathway
    102967709 (PIK3R2)
   04071 Sphingolipid signaling pathway
    102967709 (PIK3R2)
   04024 cAMP signaling pathway
    102967709 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    102967709 (PIK3R2)
   04152 AMPK signaling pathway
    102967709 (PIK3R2)
   04150 mTOR signaling pathway
    102967709 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102967709 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    102967709 (PIK3R2)
   04218 Cellular senescence
    102967709 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102967709 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102967709 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102967709 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102967709 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    102967709 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    102967709 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    102967709 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    102967709 (PIK3R2)
   04660 T cell receptor signaling pathway
    102967709 (PIK3R2)
   04662 B cell receptor signaling pathway
    102967709 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    102967709 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    102967709 (PIK3R2)
   04670 Leukocyte transendothelial migration
    102967709 (PIK3R2)
   04062 Chemokine signaling pathway
    102967709 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102967709 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    102967709 (PIK3R2)
   04929 GnRH secretion
    102967709 (PIK3R2)
   04915 Estrogen signaling pathway
    102967709 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    102967709 (PIK3R2)
   04917 Prolactin signaling pathway
    102967709 (PIK3R2)
   04926 Relaxin signaling pathway
    102967709 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    102967709 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    102967709 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102967709 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102967709 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    102967709 (PIK3R2)
   04722 Neurotrophin signaling pathway
    102967709 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102967709 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    102967709 (PIK3R2)
   04380 Osteoclast differentiation
    102967709 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    102967709 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    102967709 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102967709 (PIK3R2)
   05206 MicroRNAs in cancer
    102967709 (PIK3R2)
   05205 Proteoglycans in cancer
    102967709 (PIK3R2)
   05203 Viral carcinogenesis
    102967709 (PIK3R2)
   05230 Central carbon metabolism in cancer
    102967709 (PIK3R2)
   05231 Choline metabolism in cancer
    102967709 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102967709 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102967709 (PIK3R2)
   05212 Pancreatic cancer
    102967709 (PIK3R2)
   05225 Hepatocellular carcinoma
    102967709 (PIK3R2)
   05226 Gastric cancer
    102967709 (PIK3R2)
   05214 Glioma
    102967709 (PIK3R2)
   05221 Acute myeloid leukemia
    102967709 (PIK3R2)
   05220 Chronic myeloid leukemia
    102967709 (PIK3R2)
   05218 Melanoma
    102967709 (PIK3R2)
   05211 Renal cell carcinoma
    102967709 (PIK3R2)
   05215 Prostate cancer
    102967709 (PIK3R2)
   05213 Endometrial cancer
    102967709 (PIK3R2)
   05224 Breast cancer
    102967709 (PIK3R2)
   05222 Small cell lung cancer
    102967709 (PIK3R2)
   05223 Non-small cell lung cancer
    102967709 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102967709 (PIK3R2)
   05017 Spinocerebellar ataxia
    102967709 (PIK3R2)
   05020 Prion disease
    102967709 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102967709 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102967709 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    102967709 (PIK3R2)
   04931 Insulin resistance
    102967709 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102967709 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102967709 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    102967709 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102967709 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    102967709 (PIK3R2)
   05161 Hepatitis B
    102967709 (PIK3R2)
   05160 Hepatitis C
    102967709 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    102967709 (PIK3R2)
   05164 Influenza A
    102967709 (PIK3R2)
   05162 Measles
    102967709 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    102967709 (PIK3R2)
   05163 Human cytomegalovirus infection
    102967709 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102967709 (PIK3R2)
   05169 Epstein-Barr virus infection
    102967709 (PIK3R2)
   05165 Human papillomavirus infection
    102967709 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102967709 (PIK3R2)
   05142 Chagas disease
    102967709 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102967709 (PIK3R2)
   01524 Platinum drug resistance
    102967709 (PIK3R2)
   01522 Endocrine resistance
    102967709 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102967709 (PIK3R2)
Membrane trafficking [BR:ptg04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102967709 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP ATG11 Ribosomal_L22e DUF4201 Tai4 Laminin_I
Other DBs
NCBI-GeneID: 102967709
NCBI-ProteinID: XP_015395825
LinkDB
Position
Un
AA seq 530 aa
MAPTFGLPGFTRPYREPPTRGFRQRRPGVLPGTPPTRCPLLPGLTLPDLPEQFSPPDVAP
PLLVKLVEAIERTGLDSESLYRPELPAPRTDWSLSDVEQWDATALADGVKGFLLALPAPL
VTPQTRLTLPTPCAPLPPRTEPSPDFPALLVEKLLQEHLEEQEVAPPALPPKPPKAKPAP
AGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGG
NNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLYPVSKYQQDQI
VKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEE
QGQTQEKCSKEYLERFRREGNEKEMQRXPPLPQDPXXXKPRIAEIHESRTKLEQELRAQA
SDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQYALMED
EDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVV
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggccccaacctttggcctgcccggttttacccgaccctaccgggagccgcccacgcgg
gggttcaggcaaagaaggcctggagtccttccagggaccccaccgacacgctgtcccctt
ctgccaggcctcacgctccctgacctgccagagcagttctccccacctgatgtggctccc
ccgctcctggtgaagctcgtggaggccattgagcggacagggctagacagcgaatccctc
tacaggcctgagctgcccgccccgcgcacagactggtccctgagcgacgtggagcagtgg
gacgccacagccctggcagatggcgtcaagggcttcctgctggcgctgcccgcccccctc
gtgacaccgcagacgaggctcaccctacctaccccctgcgctccccttccccctaggact
gagcccagccctgacttcccggcgttgctggtggagaagttgcttcaggaacatctggaa
gagcaggaggtcgcacccccagcgctgccgcccaaaccccccaaggccaagccagccccc
gcaggcctagccaatggggggagcccgccctccctgcaggatgccgagtggtactggggt
gacatctccagggaggaagtgaatgagaaactccgggacacacccgacggcacctttctg
gtccgagatgcatccagcaagatccagggggaatacacactgaccctcaggaaaggcggg
aacaacaagctgattaaggtcttccatcgtgacgggcactatggcttctcagagccgctc
accttctgctccgttgtggacctcatcacccactaccgccacgagtcgctggcccagtac
aatgccaaactggacacacggctcctctacccggtgtccaagtaccagcaggaccagatc
gtcaaggaggacagcgtggaggcggtgggcgcccagctcaaagtctatcaccagcagtac
caggacaagagccgcgagtacgaccagctgtacgaggagtacacacgcacctcccaggag
ttgcagatgaagcgcacagcaatcgaggccttcaacgagaccatcaagatctttgaagag
cagggccagacacaagagaagtgtagcaaggagtatttggagcgcttccggcgtgagggc
aacgagaaagagatgcagaggtgaccgcccctcccacaggatcctnnnnnnntcaagccc
cgcatcgccgagatccacgagagccgcacgaagctggagcaggagctgcgggcacaggcc
tccgacaaccgggagatcgacaagcgcatgaacagcctcaagccagacctcatgcagctc
cgcaagatccgagaccagtacctcgtgtggcttacccagaaaggtgcccggcagaagaaa
atcaacgagtggttggggatcaaaaatgagaccgaggaccagtatgcgctgatggaagac
gaggatgacctcccccaccacgaggaacgcacgtggtacgtgggcaagatcaaccgcacg
caggctgaggaaatgctgagtggcaagcgggatggcaccttcctcatccgcgagagcagc
cagcggggctgctatgcctgctctgtggtgtga

KEGG   Panthera tigris altaica (Amur tiger): 102972487
Entry
102972487         CDS       T02988                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00562  Inositol phosphate metabolism
ptg01100  Metabolic pathways
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04070  Phosphatidylinositol signaling system
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04140  Autophagy - animal
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04152  AMPK signaling pathway
ptg04210  Apoptosis
ptg04211  Longevity regulating pathway
ptg04213  Longevity regulating pathway - multiple species
ptg04218  Cellular senescence
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04620  Toll-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04666  Fc gamma R-mediated phagocytosis
ptg04668  TNF signaling pathway
ptg04670  Leukocyte transendothelial migration
ptg04722  Neurotrophin signaling pathway
ptg04725  Cholinergic synapse
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04810  Regulation of actin cytoskeleton
ptg04910  Insulin signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04915  Estrogen signaling pathway
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04923  Regulation of lipolysis in adipocytes
ptg04926  Relaxin signaling pathway
ptg04929  GnRH secretion
ptg04930  Type II diabetes mellitus
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg04960  Aldosterone-regulated sodium reabsorption
ptg04973  Carbohydrate digestion and absorption
ptg05010  Alzheimer disease
ptg05017  Spinocerebellar ataxia
ptg05020  Prion disease
ptg05100  Bacterial invasion of epithelial cells
ptg05132  Salmonella infection
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05146  Amoebiasis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05218  Melanoma
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102972487 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102972487 (PIK3CB)
   04014 Ras signaling pathway
    102972487 (PIK3CB)
   04015 Rap1 signaling pathway
    102972487 (PIK3CB)
   04370 VEGF signaling pathway
    102972487 (PIK3CB)
   04630 JAK-STAT signaling pathway
    102972487 (PIK3CB)
   04668 TNF signaling pathway
    102972487 (PIK3CB)
   04066 HIF-1 signaling pathway
    102972487 (PIK3CB)
   04068 FoxO signaling pathway
    102972487 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102972487 (PIK3CB)
   04072 Phospholipase D signaling pathway
    102972487 (PIK3CB)
   04071 Sphingolipid signaling pathway
    102972487 (PIK3CB)
   04024 cAMP signaling pathway
    102972487 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    102972487 (PIK3CB)
   04152 AMPK signaling pathway
    102972487 (PIK3CB)
   04150 mTOR signaling pathway
    102972487 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102972487 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    102972487 (PIK3CB)
   04218 Cellular senescence
    102972487 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102972487 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    102972487 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102972487 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102972487 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    102972487 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    102972487 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    102972487 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    102972487 (PIK3CB)
   04660 T cell receptor signaling pathway
    102972487 (PIK3CB)
   04662 B cell receptor signaling pathway
    102972487 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    102972487 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    102972487 (PIK3CB)
   04670 Leukocyte transendothelial migration
    102972487 (PIK3CB)
   04062 Chemokine signaling pathway
    102972487 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102972487 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    102972487 (PIK3CB)
   04929 GnRH secretion
    102972487 (PIK3CB)
   04915 Estrogen signaling pathway
    102972487 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102972487 (PIK3CB)
   04917 Prolactin signaling pathway
    102972487 (PIK3CB)
   04926 Relaxin signaling pathway
    102972487 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    102972487 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    102972487 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102972487 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102972487 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    102972487 (PIK3CB)
   04722 Neurotrophin signaling pathway
    102972487 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102972487 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    102972487 (PIK3CB)
   04380 Osteoclast differentiation
    102972487 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    102972487 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    102972487 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102972487 (PIK3CB)
   05206 MicroRNAs in cancer
    102972487 (PIK3CB)
   05205 Proteoglycans in cancer
    102972487 (PIK3CB)
   05203 Viral carcinogenesis
    102972487 (PIK3CB)
   05230 Central carbon metabolism in cancer
    102972487 (PIK3CB)
   05231 Choline metabolism in cancer
    102972487 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102972487 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102972487 (PIK3CB)
   05212 Pancreatic cancer
    102972487 (PIK3CB)
   05225 Hepatocellular carcinoma
    102972487 (PIK3CB)
   05226 Gastric cancer
    102972487 (PIK3CB)
   05214 Glioma
    102972487 (PIK3CB)
   05221 Acute myeloid leukemia
    102972487 (PIK3CB)
   05220 Chronic myeloid leukemia
    102972487 (PIK3CB)
   05218 Melanoma
    102972487 (PIK3CB)
   05211 Renal cell carcinoma
    102972487 (PIK3CB)
   05215 Prostate cancer
    102972487 (PIK3CB)
   05213 Endometrial cancer
    102972487 (PIK3CB)
   05224 Breast cancer
    102972487 (PIK3CB)
   05222 Small cell lung cancer
    102972487 (PIK3CB)
   05223 Non-small cell lung cancer
    102972487 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102972487 (PIK3CB)
   05017 Spinocerebellar ataxia
    102972487 (PIK3CB)
   05020 Prion disease
    102972487 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102972487 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102972487 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    102972487 (PIK3CB)
   04931 Insulin resistance
    102972487 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102972487 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102972487 (PIK3CB)
   05135 Yersinia infection
    102972487 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    102972487 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102972487 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    102972487 (PIK3CB)
   05161 Hepatitis B
    102972487 (PIK3CB)
   05160 Hepatitis C
    102972487 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    102972487 (PIK3CB)
   05164 Influenza A
    102972487 (PIK3CB)
   05162 Measles
    102972487 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    102972487 (PIK3CB)
   05163 Human cytomegalovirus infection
    102972487 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102972487 (PIK3CB)
   05169 Epstein-Barr virus infection
    102972487 (PIK3CB)
   05165 Human papillomavirus infection
    102972487 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102972487 (PIK3CB)
   05142 Chagas disease
    102972487 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102972487 (PIK3CB)
   01524 Platinum drug resistance
    102972487 (PIK3CB)
   01522 Endocrine resistance
    102972487 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102972487 (PIK3CB)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102972487 (PIK3CB)
Membrane trafficking [BR:ptg04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102972487 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 102972487
NCBI-ProteinID: XP_007087499
LinkDB
Position
Un
AA seq 1070 aa
MCFNFIMPPAMADILDIWAVDSQLASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPEH
EPSILENLEDKLYGGKLIVAVHFENCQDVFSFQISPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFMLVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKMRIISHVWENNNPFQIVLVKGNKLNTEESVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINICDLPRMARLCFAIYAVLDKVKTKKSTKTI
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIKEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEVLKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttcaatttcataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagttagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatattcagttggaggttcctcgggaagctaccatttcctatattaaacagatgttatgg
aagcaagttcacaattacccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagcttgaagatgaaacaagaaggctctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctacatgaatttgatgcactg
aaggatcctgaagtgaatgaattccgaataaaaatgcgcaaattcagtgaagaaaagatt
cagtcacttgtgggattgtcttggatggattggctaaaacagacgtatccaccagaacat
gaaccatccatccttgaaaacttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaaatatctcctaatatgaatcct
atcaaaataaatgaactggcaatccaaaaacgtttgactattcatgggaaagaagatgaa
gttagcccgtatgactatgtgttacaagtcagtgggcgagtagaatatgtgtttggtgat
cacccactaattcagttccagtatatccggaactgtgtaatgaataggaccttgcctcat
tttatgcttgtggaatgttgcaagatcaagaagatgtatgaacaggaaatgattgccata
gaagctgccataaatagaaattcatcaaaccttcctcttcctttaccaccaaagaaaatg
cgaattatttctcatgtttgggaaaataacaaccctttccaaattgtcttggttaaggga
aataaacttaacacagaagaaagtgtaaaagttcatgtcagggctggcctttttcatggt
accgaactcctgtgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaccactggaatttgatataaatatttgtgacctgccacgaatggctcgatta
tgttttgctatttatgcagttttggataaagtgaaaacgaaaaaatcgactaaaactatt
aatccctctaaatatcagaccatccggaaatctgggaaagtgcattatcctgtagcatgg
gtaaatacaatggtttttgactttaaaggacagttgagatctggagacataatattgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcag
acaaatccatatacagaaaatgcaacagctttgcatatcaaattcccagagaataaaaaa
caaccttattattatcctccctttgataagataaaggagaaggcagctgagattgcaagc
agtgacagtgctaatgtatcaagtcgaggtggaaaaaagtttcttgctgtactgaaagaa
atcttggacagggatcccttgtctcaactgtgtgagaacgaaatggatcttatttggact
ttgcgacaagattgcagagagaatttcccacagtcactgccaaaattactgctgtcgatc
aagtggaataaacttgaagatgttgctcagcttcaagccctacttcagatttggcctaaa
ctgcccccccgggaggccttggagcttctagatttcaactatccagatcagtacgtgcga
gaatatgctgtgggctgcctgcgacagatgagtgatgaagaactctctcaatatctttta
caactggtgcaagttttgaaatacgagccttttcttgattgtgccctctctagattccta
ttagaaagagcacttgctaaccgcaggatagggcagtttctattttggcaccttaggtca
gaagtgcatattcctgctgtctcagtacagtttggtgtcatccttgaagcatactgccgg
ggaagtgtagggcatatgaaagtgctttctaagcaggttgaagcactcaataagttaaaa
actttaaatagtttaatcaaactgaatgcaatgaagctaaacagagccaaagggaaggag
gccatgcatacttgtttaaaacagaatgcttaccgggaagccctctctgacctgcagtca
cctctgaatccgtgtgtcatcctctcagaactctatgttgaaaaatgtaaatacatggat
tccaaaatgaagcctttgtggctcgtgtacaacaacaaagtttttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaagatatgttgacactccagatgttg
cgcttgatggatttactttggaaagaagctggtctggatcttcggatgctgccttatggc
tgtttagcaacaggagaccgctctggcctcatcgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgcagcagcggccttcaacaaagacgcc
cttctgaactggcttaaagaatacaactctggggatgacctagaccgagccattgaagag
tttaccttgtcctgtgccggctactgtgtagcttcttatgtccttgggattggtgataga
catagtgacaacatcatggtcaagaaaaccggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggaacgagtgccttttattctt
acctatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagaaaaatttggc
cgtttccgccagtgttgtgaggatgcatatctgattttacgacgtcacgggaatctcttc
atcactctttttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatcttaaggactctcttgccttaggaaagagtgaagaagaagtgctaaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

DBGET integrated database retrieval system