KEGG   Panthera tigris altaica (Amur tiger): 102972342
Entry
102972342         CDS       T02988                                 

Gene name
CD40
Definition
(RefSeq) CD40 molecule
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04064  NF-kappa B signaling pathway
ptg04514  Cell adhesion molecules
ptg04620  Toll-like receptor signaling pathway
ptg04672  Intestinal immune network for IgA production
ptg05144  Malaria
ptg05145  Toxoplasmosis
ptg05166  Human T-cell leukemia virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05202  Transcriptional misregulation in cancer
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05322  Systemic lupus erythematosus
ptg05330  Allograft rejection
ptg05340  Primary immunodeficiency
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102972342 (CD40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102972342 (CD40)
   04514 Cell adhesion molecules
    102972342 (CD40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102972342 (CD40)
   04672 Intestinal immune network for IgA production
    102972342 (CD40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102972342 (CD40)
  09163 Immune disease
   05310 Asthma
    102972342 (CD40)
   05322 Systemic lupus erythematosus
    102972342 (CD40)
   05320 Autoimmune thyroid disease
    102972342 (CD40)
   05330 Allograft rejection
    102972342 (CD40)
   05340 Primary immunodeficiency
    102972342 (CD40)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102972342 (CD40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102972342 (CD40)
   05169 Epstein-Barr virus infection
    102972342 (CD40)
  09174 Infectious disease: parasitic
   05144 Malaria
    102972342 (CD40)
   05145 Toxoplasmosis
    102972342 (CD40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ptg04050]
    102972342 (CD40)
   04090 CD molecules [BR:ptg04090]
    102972342 (CD40)
Cytokine receptors [BR:ptg04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102972342 (CD40)
CD molecules [BR:ptg04090]
 Proteins
  102972342 (CD40)
SSDB
Motif
Pfam: TNFR_c6 Glycophorin_A RANK_CRD_2
Other DBs
NCBI-GeneID: 102972342
NCBI-ProteinID: XP_007077852
LinkDB
Position
Un
AA seq 279 aa
MVLLPLRCLLWGCVLTAVHPEPRTTCRENEYLINSRCCDKCQPGKKLVNDCTEFTSTECV
PCKKGEFLDTWNIERHCHQHKYCDPNQGLQVQREGTSETDTTCTCDEGLHCTSDACESCI
QHTLCPPGLGVKQVATGVSDTTCHPCPAGFFSNVSSASEKCHPWTRCETKGLVELQAGTN
KTDAVCGFQDRIRALVVIPITMVVLLAVLLVSAYIRKVTKKPENKVLQPKAVSQDPVEDL
EVLPVSLHPIAPVQETLHGCQPVTQEDGKESRISVQERV
NT seq 840 nt   +upstreamnt  +downstreamnt
atggttcttctgcctctgcgctgtctcctctggggctgcgtgttgaccgccgtccaccca
gaaccacgcacgacgtgcagagaaaacgagtacctgataaacagtcggtgctgtgataag
tgccagccaggaaagaaactggtgaatgactgcacagagttcacctccacggaatgcgtt
ccttgcaaaaaaggcgaattcctagacacttggaacatagagagacactgtcaccagcac
aagtactgcgaccccaaccaagggctccaggtccagagggaaggcacctcagaaactgac
accacttgcacatgtgacgaaggtctacactgtaccagcgacgcctgtgaaagctgcatc
cagcacaccctgtgcccccctggccttggggtcaagcaggttgctacaggggtttctgat
accacctgccatccgtgcccagccggcttcttctccaatgtgtcatctgcttcggaaaag
tgtcacccttggacgaggtgtgagaccaaaggcctggtggagcttcaggcggggaccaac
aagacggatgctgtctgcggtttccaggatcggataagagccctggtggtgatccccatc
acgatggtggtcctgcttgctgtcttgttggtgtctgcctatatcagaaaggtgaccaag
aagccagagaataaggtcctccagcctaaggctgtgtcgcaggaccctgtggaggacttg
gaggtccttcctgtctccctccaccccattgccccggtgcaggagaccttacacgggtgt
cagccggtcacccaggaggacggcaaagagagccgcatctcggtgcaggagagagtatga

DBGET integrated database retrieval system