KEGG   Pan troglodytes (chimpanzee): 100612300
Entry
100612300         CDS       T01005                                 

Gene name
FCER1G
Definition
(RefSeq) high affinity immunoglobulin epsilon receptor subunit gamma
  KO
K07983  high affinity immunoglobulin epsilon receptor subunit gamma
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04611  Platelet activation
ptr04625  C-type lectin receptor signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04664  Fc epsilon RI signaling pathway
ptr05152  Tuberculosis
ptr05310  Asthma
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100612300 (FCER1G)
   04071 Sphingolipid signaling pathway
    100612300 (FCER1G)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100612300 (FCER1G)
   04625 C-type lectin receptor signaling pathway
    100612300 (FCER1G)
   04650 Natural killer cell mediated cytotoxicity
    100612300 (FCER1G)
   04664 Fc epsilon RI signaling pathway
    100612300 (FCER1G)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100612300 (FCER1G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100612300 (FCER1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    100612300 (FCER1G)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100612300 (FCER1G)
SSDB
Motif
Pfam: TCR_zetazeta ITAM
Other DBs
NCBI-GeneID: 100612300
NCBI-ProteinID: XP_003949670
Ensembl: ENSPTRG00000001579
VGNC: 6818
UniProt: H2Q0G3 A0A6D2XW35
LinkDB
Position
1
AA seq 86 aa
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
SDGVYTGLSTRNQETYETLKHEKPPQ
NT seq 261 nt   +upstreamnt  +downstreamnt
atgattccagcagtggtcttgctcttactccttttggttgaacaagcagcggccctggga
gagcctcagctctgctatatcctggacgccatcctgtttctgtatggaattgtcctcacc
ctcctctactgtcgactgaagatccaagtgcgaaaggcagctataaccagctatgagaaa
tcagatggtgtttacacgggcctgagcaccaggaaccaggagacttacgagactctgaag
catgagaaaccaccacagtag

DBGET integrated database retrieval system