KEGG   Pan troglodytes (chimpanzee): 107976801
Entry
107976801         CDS       T01005                                 

Gene name
ABL1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04110  Cell cycle
ptr04360  Axon guidance
ptr04722  Neurotrophin signaling pathway
ptr05200  Pathways in cancer
ptr05206  MicroRNAs in cancer
ptr05220  Chronic myeloid leukemia
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107976801 (ABL1)
   04014 Ras signaling pathway
    107976801 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107976801 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107976801 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    107976801 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107976801 (ABL1)
   05206 MicroRNAs in cancer
    107976801 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    107976801 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107976801 (ABL1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107976801 (ABL1)
Protein kinases [BR:ptr01001]
 Non-receptor tyrosine kinases
  ABL family
   107976801 (ABL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Kinase-like SH3_6
Other DBs
NCBI-GeneID: 107976801
NCBI-ProteinID: XP_016817367
VGNC: 4596
UniProt: A0A2I3S7G9
LinkDB
Position
9
AA seq 1149 aa
MGQQPGKVLGDQRRPSLPALHFIKGAGKKESSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVST
LLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGAPE
GGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDI
SNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATG
EEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPA
LPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQ
VTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKASSGAPGGTSKGPAEESRVRRHKHS
SESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAV
NSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTA
FIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGK
NLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSV
KEISDIVQR
NT seq 3450 nt   +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccaaagaaggccaagcttgcctgccctg
cattttatcaaaggagcagggaagaaggaatcatcgaggcatgggggtccacactgcaat
gtttttgtggaacatgaagcccttcagcggccagtagcatctgactttgagcctcagggt
ctgagtgaagccgctcgttggaactccaaggaaaaccttctcgctggacccagtgaaaat
gaccccaaccttttcgttgcactgtatgattttgtggccagtggagataacactctaagc
ataactaaaggtgaaaagctccgggtcttaggctataatcacaatggggaatggtgtgaa
gcccaaaccaaaaatggccaaggctgggtcccaagcaactacatcacgccagtcaacagt
ctggagaaacactcctggtaccatgggcctgtgtcccgcaatgctgctgagtatctgctg
agcagcgggatcaatggcagcttcttggtgcgtgagagtgagagcagtcctggccagagg
tccatctcgctgagatacgaagggagggtgtaccattacaggatcaacactgcttctgat
ggcaagctctacgtctcctccgagagccgcttcaacaccctggccgagttggttcatcat
cattcaacggtggccgacgggctcatcaccacgctccattatccagccccaaagcgcaac
aagcccactgtctacggtgtgtcccccaactacgacaagtgggagatggaacgcacggac
atcaccatgaagcacaagctgggtgggggccagtacggggaggtgtacgagggtgtgtgg
aagaaatacagcctgacggtggccgtgaagaccttgaaggaggacaccatggaggtggaa
gagttcttgaaagaagctgcagtcatgaaagagatcaaacaccctaacctggtgcagctc
cttggggtctgcacccgggagcccccgttctatatcatcactgagttcatgacctacggg
aacctcctggactacctgagggagtgcaaccggcaggaggtgaacgccgtggtgctgctg
tacatggccactcagatctcgtcagccatggagtacctggagaagaaaaacttcatccac
agagatcttgctgcccgaaactgcctggtaggggagaaccacttggtgaaggtagctgat
tttggcctgagcaggttgatgacaggggacacctacacagcccatgctggagccaagttc
cccatcaaatggactgcacccgagagcctggcctacaacaagttctccatcaagtccgac
gtctgggcatttggagtattgctttgggaaattgctacctatggcatgtccccttacccg
ggaattgacctgtcccaggtgtatgagctgctagagaaggactaccgcatggagcgccca
gaaggctgcccagagaaggtctatgaactcatgcgagcatgttggcagtggaatccctct
gaccggccctcctttgctgaaatccaccaagcctttgaaacaatgttccaggaatccagt
atctcagacgaagtggaaaaggagctggggaaacaaggcgtccgtggggctgtgagtacc
ttgctgcaggccccagagctgcccaccaagacaaggacctccaggagagctgcagagcac
agagacaccactgacgtgcctgagatgcctcactccaagggccagggagagagcgatcct
ctggaccatgagcctgccgtgtctccattgctccctcgaaaagagcgaggtgccccggag
ggcggcctgaatgaagatgagcgccttctccccaaagacaaaaagaccaacttgttcagc
gccttgatcaagaagaagaagaagacagccccaacccctcccaaacgcagcagctccttc
cgggagatggacggccagccggagcgcagaggggccggcgaggaagagggccgagacatc
agcaacggggcgctggctttcacccccttggacacagcggacccagccaagtccccaaag
cccagcaatggggctggggtccccaatggagccctccgggagtccgggggctcaggcttc
cggtctccccacctgtggaagaagtccagcacgctgaccagcagccgcctagccaccggc
gaggaggagggcggtggcagctccagcaagcgcttcctgcgctcctgctccgcctcctgc
gttccccatggggccaaggacacggagtggaggtcagtcacgctgcctcgggacttgcag
tccacgggaagacagtttgactcgtccacatttggagggcacaaaagtgagaagccggct
ctgcctcggaagagggcaggggagaacaggtctgaccaggtgacccgaggcacagtaacg
ccccctcccaggctggtgaaaaagaatgaggaagctgctgatgaggtcttcaaagacatc
atggagtccagcccgggctccagcccgcccaacctgactccaaaacccctccggcggcag
gtcaccgtggcccctgcctcgggcctcccccacaaggaagaagctggaaagggcagtgcc
ttagggacccctgctgcagctgagccagtgacccccaccagcaaagcaagctcaggtgca
ccagggggcaccagcaagggccccgccgaggagtccagagtgaggaggcacaagcactcc
tctgagtcgccagggagggacaaggggaaattgtccaggctcaaacctgccccgccgccc
ccaccagcagcctctgcagggaaggctggaggaaagccctcgcagagcccgagccaggag
gcggccggggaggcagtcctgggcgcaaagacaaaagccacgagtctggttgatgctgtg
aacagtgacgctgccaagcccagccagccgggagagggcctcaaaaagcccgtgctcccg
gccactccaaagccacagtccgccaagccgtcggggacccccatcagcccagcccccgtt
ccctccacgttgccatcagcatcctcggccctggcaggggaccagccatcttccaccgcc
ttcatccctctcatatcaacccgagtgtctcttcggaaaacccgccagcctccagagcgg
atcgccagtggcgccatcaccaagggcgtggtcctggacagcaccgaggcgctgtgcctc
gccatctctaggaactccgagcagatggccagccacagcgcagtgctggaggccggcaaa
aacctctacacgttctgcgtgagctacgtggattccatccagcaaatgaggaacaagttt
gccttccgagaggccatcaacaaactggagaataatctccgggagcttcagatctgcccg
gcgacagcaggcagtggtccggcggccactcaggacttcagcaagctcctcagttcggtg
aaggaaatcagtgacatagtgcagaggtag

KEGG   Pan troglodytes (chimpanzee): 458694
Entry
458694            CDS       T01005                                 

Gene name
BCR
Definition
(RefSeq) breakpoint cluster region protein isoform X1
  KO
K08878  breakpoint cluster region protein [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr05200  Pathways in cancer
ptr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    458694 (BCR)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    458694 (BCR)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     458694 (BCR)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: Other
  BCR family
   458694 (BCR)
Membrane trafficking [BR:ptr04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    458694 (BCR)
SSDB
Motif
Pfam: RhoGAP Bcr-Abl_Oligo RhoGEF PH_19 C2 PH IQ_SEC7_PH PH_5
Other DBs
NCBI-GeneID: 458694
NCBI-ProteinID: XP_016795020
Ensembl: ENSPTRG00000014138
VGNC: 10390
LinkDB
Position
22
AA seq 1294 aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQAPDGASEPRGSASRPQPAPADGADPPPAEEPEARPDGE
GSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRTSESSC
GVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQSIYVGGMMEGEGKGPLLRSQ
STSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEG
AFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALVSG
ALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGV
AMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDL
LKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVE
GARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEAVPNIPLVP
DEELDALKIKISQIKSDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRN
GKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTIN
KEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNE
EFEIELEGSQTLRILCYEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVI
AMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIER
RGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLF
TDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSL
HNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQGPRAGGCFGSTATSYQPP
ASKACVVAKPVWGWGTQHSPGGGPGSPSAMQAKA
NT seq 3885 nt   +upstreamnt  +downstreamnt
atggtggacccggtgggcttcgcggaggcgtggaaggcgcagttcccggactcagagccg
ccgcgcatggagctgcgctcagtgggcgacatcgagcaggagctggagcgctgcaaggcc
tccattcggcgcctggagcaggaggtgaaccaggagcgcttccgcatgatctacctgcag
acgttgctggccaaggaaaagaagagctatgaccggcagcgatggggcttccggcgcgcg
gcgcaggcccccgacggcgcctccgagccccgagggtccgcgtcgcgcccgcagccagcg
cccgccgacggagccgacccgccgcccgccgaggagcccgaggcccggcccgacggcgag
ggttctccgggtaaggccaggcccgggaccgcccgcaggcccggggcagccgcgtcgggg
gaacgggacgaccggggaccccccgccagcgtggcggcgctcaggtccaacttcgagcgg
atccgcaagggccatggccagcccggggcggacgccgagaagcccttctacgtgaacgtc
gagtttcaccacgagcgcggcctggtgaaggtcaacgacaaagaggtgtcggaccgcatc
agctctctgggcagccaggccatgcagatggagcgcaaaaagtcccagcacggcgcgggc
tcgagcgtgggggatgcatccaggcccccttaccggggacgcacctcggagagcagctgc
ggcgtcgacggcgactacgaggacgccgagttgaacccccgcttcctgaaggacaacctg
atcgacgccaatggcggtagcaggcccccttggccgcccctggagtaccagccctaccag
agcatctacgtcgggggcatgatggaaggggagggcaagggcccgctcctgcgcagccag
agcacctctgagcaggagaagcgccttacctggccccgcaggtcctactccccccggagt
tttgaggattgcggaggcggctataccccggactgcagctccaatgagaacctcacctcc
agcgaggaggacttctcctctggccagtccagccgcgtgtccccaagccccaccacctac
cgcatgttccgggacaagagccgttctccctcgcagaactcgcaacagtccttcgacagc
agcagtccccccacgccgcagtgccataagcggcaccggcactgcccggttgtcgtgtcc
gaggccaccatcgtgggcgtccgcaagaccgggcagatctggcccaacgatggcgagggc
gccttccatggagacgcagatggctcgttcggaacaccacctggatacggctgcgctgca
gaccgggcagaggagcagcgccggcaccaagatgggctgccctacattgatgactcgccc
tcctcatcgccccacctcagcagcaagggcaggggcagccgggatgcgctggtctcggga
gccctggagtccactaaagcgagtgagctggacttggaaaagggcttggagatgagaaaa
tgggtcctgtctggaatcctggctagcgaggaaacttacctgagccacctggaggcactg
ctgctgcccatgaagcctttgaaagccgctgccaccacctctcagccggtgctgacgagt
cagcagatcgagaccatcttcttcaaagtgcctgagctctacgagatccacaaggagttc
tatgatgggctcttcccccgcgtgcagcagtggagccaccagcagcgggtgggcgacctc
ttccagaagctggccagccagttgggtgtgtaccgggccttcgtggacaactacggagtt
gccatggaaatggctgagaagtgctgtcaggccaatgctcagtttgcagaaatctccgag
aacctgagagccagaagcaacaaagatgccaaggatccaacgaccaagaactctctggaa
actctgctctacaagcctgtggaccgtgtgacgaggagcacgctggtcctccatgacttg
ctgaagcacactcctgccagccaccctgaccaccccttgctgcaggacgccctccgcatc
tcacagaacttcctgtccagcatcaacgaggagatcacaccccgacggcagtccatgacg
gtgaagaagggagagcaccggcagctgctgaaggacagcttcatggtggagctggtggag
ggggcccgcaagctgcgccacgtcttcctgttcaccgacctgcttctctgcaccaagctc
aagaagcagagcggaggcaaaacgcagcagtatgactgcaaatggtacattccgctcacg
gatctcagcttccagatggtggatgaattggaggcagtgcccaacatccccctggtgccc
gatgaggagctggacgctttgaagatcaagatctcccagatcaagagtgacatccagaga
gagaagagggcgaacaagggcagcaaggccacagagaggctgaagaagaagctgtcggag
caggagtcgctgctgctgcttatgtctcccagcatggccttcagggtgcacagccgcaac
ggcaagagttacacgttcctgatctcctctgactatgagcgtgcagagtggagggagaac
atccgggagcagcagaagaagtgtttcagaagcttctccctgacatccgtggagctgcag
atgctgaccaactcgtgtgtgaaactccagaccgtccacagcattccgctgaccatcaac
aaggaagatgatgagtctccggggctctatgggtttctgaatgtcatcgtccactcagcc
actggatttaagcagagttcaaatctgtactgcaccctggaggtggattcctttgggtat
tttgtgaataaagcaaagacgcgcgtctacagggacacagctgagccaaactggaacgag
gaatttgagatagagctggagggctcccagaccctgaggatactgtgctatgaaaagtgt
tacaacaagacgaagatccccaaggaggacggcgagagcacggacagactcatggggaag
ggccaggtccagctggacccgcaggccctgcaggacagagactggcagcgcaccgtcatc
gccatgaatgggatcgaagtaaagctctcggtcaagttcaacagcagggagttcagcttg
aagaggatgccatcccgaaaacagacaggggtcttcggagtcaagattgctgtggtcacc
aagagagagaggtccaaggtgccctacatcgtgcgccagtgcgtggaggagatcgagcgc
cgaggcatggaggaggtgggcatctaccgcgtgtccggtgtggccacggacatccaggca
ctgaaggcagccttcgacgtcaataacaaggacgtgtcggtgatgatgagcgagatggac
gtgaacgccatcgcaggcacgctgaagctgtacttccgtgagctgcccgagcccctcttc
actgacgagttctaccccaacttcgcagagggcatcgctctttcagacccggttgcaaag
gagagctgcatgctcaacctgctgctgtccctgccggaggccaacctgctcaccttcctt
ttccttctggaccacctgaaaagggtggcagagaaggaggcagtcaataagatgtccctg
cacaacctcgccacggtctttggccccacgctgctccggccctccgagaaggagagcaag
ctccctgccaaccccagccagcctatcaccatgactgacagctggtccttggaggtcatg
tcccagggtcccagggctggtggttgctttgggtctacagctacgtcttaccagcctcct
gcctcaaaagcctgtgtggtggcaaagccggtgtggggctggggaacgcagcattctcca
ggagggggacccggctctccttctgcaatgcaggcaaaggcctag

DBGET integrated database retrieval system