KEGG   Pan troglodytes (chimpanzee): 450445
Entry
450445            CDS       T01005                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04024  cAMP signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04137  Mitophagy - animal
ptr04140  Autophagy - animal
ptr04141  Protein processing in endoplasmic reticulum
ptr04210  Apoptosis
ptr04215  Apoptosis - multiple species
ptr04217  Necroptosis
ptr04310  Wnt signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04530  Tight junction
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04723  Retrograde endocannabinoid signaling
ptr04728  Dopaminergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04910  Insulin signaling pathway
ptr04912  GnRH signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04917  Prolactin signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04926  Relaxin signaling pathway
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr05010  Alzheimer disease
ptr05012  Parkinson disease
ptr05016  Huntington disease
ptr05017  Spinocerebellar ataxia
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05162  Measles
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05231  Choline metabolism in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    450445 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    450445 (MAPK8)
   04012 ErbB signaling pathway
    450445 (MAPK8)
   04014 Ras signaling pathway
    450445 (MAPK8)
   04310 Wnt signaling pathway
    450445 (MAPK8)
   04668 TNF signaling pathway
    450445 (MAPK8)
   04068 FoxO signaling pathway
    450445 (MAPK8)
   04071 Sphingolipid signaling pathway
    450445 (MAPK8)
   04024 cAMP signaling pathway
    450445 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    450445 (MAPK8)
   04137 Mitophagy - animal
    450445 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    450445 (MAPK8)
   04215 Apoptosis - multiple species
    450445 (MAPK8)
   04217 Necroptosis
    450445 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    450445 (MAPK8)
   04530 Tight junction
    450445 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    450445 (MAPK8)
   04621 NOD-like receptor signaling pathway
    450445 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    450445 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    450445 (MAPK8)
   04660 T cell receptor signaling pathway
    450445 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    450445 (MAPK8)
   04659 Th17 cell differentiation
    450445 (MAPK8)
   04657 IL-17 signaling pathway
    450445 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    450445 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    450445 (MAPK8)
   04920 Adipocytokine signaling pathway
    450445 (MAPK8)
   04912 GnRH signaling pathway
    450445 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    450445 (MAPK8)
   04917 Prolactin signaling pathway
    450445 (MAPK8)
   04926 Relaxin signaling pathway
    450445 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    450445 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    450445 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    450445 (MAPK8)
   04722 Neurotrophin signaling pathway
    450445 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    450445 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    450445 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    450445 (MAPK8)
   05231 Choline metabolism in cancer
    450445 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    450445 (MAPK8)
   05212 Pancreatic cancer
    450445 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    450445 (MAPK8)
   05012 Parkinson disease
    450445 (MAPK8)
   05016 Huntington disease
    450445 (MAPK8)
   05017 Spinocerebellar ataxia
    450445 (MAPK8)
   05020 Prion disease
    450445 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    450445 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    450445 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    450445 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    450445 (MAPK8)
   04931 Insulin resistance
    450445 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    450445 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    450445 (MAPK8)
   05135 Yersinia infection
    450445 (MAPK8)
   05133 Pertussis
    450445 (MAPK8)
   05152 Tuberculosis
    450445 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    450445 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    450445 (MAPK8)
   05161 Hepatitis B
    450445 (MAPK8)
   05171 Coronavirus disease - COVID-19
    450445 (MAPK8)
   05162 Measles
    450445 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    450445 (MAPK8)
   05169 Epstein-Barr virus infection
    450445 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    450445 (MAPK8)
   05142 Chagas disease
    450445 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    450445 (MAPK8)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     450445 (MAPK8)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   450445 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 450445
NCBI-ProteinID: XP_001136927
Ensembl: ENSPTRG00000002478
VGNC: 14517
UniProt: A0A6D2XDJ7 K7CZW7
LinkDB
Position
10
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcattctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tctgactgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagtttt
atgatgacgccttacgtagtgactcgctactacagagcacccgaggtcatccttggcatg
ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtccttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctctgatacagacagcagtctagaagcatcagct
gggcctctgggctgctgtagatga

KEGG   Pan troglodytes (chimpanzee): 461358
Entry
461358            CDS       T01005                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X3
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04024  cAMP signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04137  Mitophagy - animal
ptr04140  Autophagy - animal
ptr04141  Protein processing in endoplasmic reticulum
ptr04210  Apoptosis
ptr04215  Apoptosis - multiple species
ptr04217  Necroptosis
ptr04310  Wnt signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04530  Tight junction
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04723  Retrograde endocannabinoid signaling
ptr04728  Dopaminergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04910  Insulin signaling pathway
ptr04912  GnRH signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04917  Prolactin signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04926  Relaxin signaling pathway
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr05010  Alzheimer disease
ptr05012  Parkinson disease
ptr05016  Huntington disease
ptr05017  Spinocerebellar ataxia
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05162  Measles
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05231  Choline metabolism in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    461358 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    461358 (MAPK10)
   04012 ErbB signaling pathway
    461358 (MAPK10)
   04014 Ras signaling pathway
    461358 (MAPK10)
   04310 Wnt signaling pathway
    461358 (MAPK10)
   04668 TNF signaling pathway
    461358 (MAPK10)
   04068 FoxO signaling pathway
    461358 (MAPK10)
   04071 Sphingolipid signaling pathway
    461358 (MAPK10)
   04024 cAMP signaling pathway
    461358 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    461358 (MAPK10)
   04137 Mitophagy - animal
    461358 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    461358 (MAPK10)
   04215 Apoptosis - multiple species
    461358 (MAPK10)
   04217 Necroptosis
    461358 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    461358 (MAPK10)
   04530 Tight junction
    461358 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    461358 (MAPK10)
   04621 NOD-like receptor signaling pathway
    461358 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    461358 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    461358 (MAPK10)
   04660 T cell receptor signaling pathway
    461358 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    461358 (MAPK10)
   04659 Th17 cell differentiation
    461358 (MAPK10)
   04657 IL-17 signaling pathway
    461358 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    461358 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    461358 (MAPK10)
   04920 Adipocytokine signaling pathway
    461358 (MAPK10)
   04912 GnRH signaling pathway
    461358 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    461358 (MAPK10)
   04917 Prolactin signaling pathway
    461358 (MAPK10)
   04926 Relaxin signaling pathway
    461358 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    461358 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    461358 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    461358 (MAPK10)
   04722 Neurotrophin signaling pathway
    461358 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    461358 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    461358 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    461358 (MAPK10)
   05231 Choline metabolism in cancer
    461358 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    461358 (MAPK10)
   05212 Pancreatic cancer
    461358 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    461358 (MAPK10)
   05012 Parkinson disease
    461358 (MAPK10)
   05016 Huntington disease
    461358 (MAPK10)
   05017 Spinocerebellar ataxia
    461358 (MAPK10)
   05020 Prion disease
    461358 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    461358 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    461358 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    461358 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    461358 (MAPK10)
   04931 Insulin resistance
    461358 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    461358 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    461358 (MAPK10)
   05135 Yersinia infection
    461358 (MAPK10)
   05133 Pertussis
    461358 (MAPK10)
   05152 Tuberculosis
    461358 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    461358 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    461358 (MAPK10)
   05161 Hepatitis B
    461358 (MAPK10)
   05171 Coronavirus disease - COVID-19
    461358 (MAPK10)
   05162 Measles
    461358 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    461358 (MAPK10)
   05169 Epstein-Barr virus infection
    461358 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    461358 (MAPK10)
   05142 Chagas disease
    461358 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    461358 (MAPK10)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     461358 (MAPK10)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   461358 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 461358
NCBI-ProteinID: XP_001156256
Ensembl: ENSPTRG00000016244
VGNC: 7423
UniProt: A0A6D2XM79 A0A2J8L2V4
LinkDB
Position
4
AA seq 426 aa
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSK
MLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEV
MNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAG
PLGCCR
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgagcaaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttc
acagttctcaagcgctaccagaatctaaagcctattggctctggggctcagggcatagtt
tgtgcggcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccc
tttcagaaccaaacacatgccaagagagcgtaccgggagctggtcctcatgaagtgtgtg
aaccataaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggag
ttccaagatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgattcag
atggaattagaccatgagcgaatgtcttacctgctgtaccaaatgttgtgtggcattaag
cacctccattctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaag
tctgattgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttc
atgatgactccatatgtggtgacacgttattacagagcccctgaggtcatcctggggatg
ggctacaaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgc
cacaaaatcctctttccaggaagggactatattgaccagtggaataaggtaattgaacaa
ctaggaacaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtg
gagaatcggcccaagtatgcgggactcaccttccccaaactcttcccagattccctcttc
ccagcggactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaag
atgctagtgattgacccagcaaaaagaatatcagtggacgacgccttacagcatccctac
atcaacgtctggtatgacccagccgaagtggaggcgcctccacctcagatatatgacaag
cagttggatgaaagagaacacacaatcgaagaatggaaagaacttatctacaaggaagta
atgaattcagaagaaaagactaaaaatggtgtagtaaaaggacagccttctccttcaggt
gcagcagtgaacagcagtgagagtctccctccatcctcgtctgtcaatgacatctcctcc
atgtccaccgaccagaccctggcatctgacactgacagcagcctggaagcctcggcagga
cccctgggttgttgcaggtga

KEGG   Pan troglodytes (chimpanzee): 462336
Entry
462336            CDS       T01005                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04024  cAMP signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04137  Mitophagy - animal
ptr04140  Autophagy - animal
ptr04141  Protein processing in endoplasmic reticulum
ptr04210  Apoptosis
ptr04215  Apoptosis - multiple species
ptr04217  Necroptosis
ptr04310  Wnt signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04530  Tight junction
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04723  Retrograde endocannabinoid signaling
ptr04728  Dopaminergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04910  Insulin signaling pathway
ptr04912  GnRH signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04917  Prolactin signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04926  Relaxin signaling pathway
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr05010  Alzheimer disease
ptr05012  Parkinson disease
ptr05016  Huntington disease
ptr05017  Spinocerebellar ataxia
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05162  Measles
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05231  Choline metabolism in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    462336 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    462336 (MAPK9)
   04012 ErbB signaling pathway
    462336 (MAPK9)
   04014 Ras signaling pathway
    462336 (MAPK9)
   04310 Wnt signaling pathway
    462336 (MAPK9)
   04668 TNF signaling pathway
    462336 (MAPK9)
   04068 FoxO signaling pathway
    462336 (MAPK9)
   04071 Sphingolipid signaling pathway
    462336 (MAPK9)
   04024 cAMP signaling pathway
    462336 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    462336 (MAPK9)
   04137 Mitophagy - animal
    462336 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    462336 (MAPK9)
   04215 Apoptosis - multiple species
    462336 (MAPK9)
   04217 Necroptosis
    462336 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    462336 (MAPK9)
   04530 Tight junction
    462336 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    462336 (MAPK9)
   04621 NOD-like receptor signaling pathway
    462336 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    462336 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    462336 (MAPK9)
   04660 T cell receptor signaling pathway
    462336 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    462336 (MAPK9)
   04659 Th17 cell differentiation
    462336 (MAPK9)
   04657 IL-17 signaling pathway
    462336 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    462336 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    462336 (MAPK9)
   04920 Adipocytokine signaling pathway
    462336 (MAPK9)
   04912 GnRH signaling pathway
    462336 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    462336 (MAPK9)
   04917 Prolactin signaling pathway
    462336 (MAPK9)
   04926 Relaxin signaling pathway
    462336 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    462336 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    462336 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    462336 (MAPK9)
   04722 Neurotrophin signaling pathway
    462336 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    462336 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    462336 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    462336 (MAPK9)
   05231 Choline metabolism in cancer
    462336 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    462336 (MAPK9)
   05212 Pancreatic cancer
    462336 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    462336 (MAPK9)
   05012 Parkinson disease
    462336 (MAPK9)
   05016 Huntington disease
    462336 (MAPK9)
   05017 Spinocerebellar ataxia
    462336 (MAPK9)
   05020 Prion disease
    462336 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    462336 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    462336 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    462336 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    462336 (MAPK9)
   04931 Insulin resistance
    462336 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    462336 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    462336 (MAPK9)
   05135 Yersinia infection
    462336 (MAPK9)
   05133 Pertussis
    462336 (MAPK9)
   05152 Tuberculosis
    462336 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    462336 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    462336 (MAPK9)
   05161 Hepatitis B
    462336 (MAPK9)
   05171 Coronavirus disease - COVID-19
    462336 (MAPK9)
   05162 Measles
    462336 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    462336 (MAPK9)
   05169 Epstein-Barr virus infection
    462336 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    462336 (MAPK9)
   05142 Chagas disease
    462336 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    462336 (MAPK9)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     462336 (MAPK9)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   462336 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 462336
NCBI-ProteinID: XP_001154685
Ensembl: ENSPTRG00000017633
VGNC: 8627
UniProt: H2QS62 A0A6D2XZB9
LinkDB
Position
5
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaaccttc
actgtcctaaaacgttaccagcagctgaaaccaattggctctggggcccaagggattgtt
tgtgctgcatttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaaccaaactcatgcaaagagagcttatcgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagctggatcatgaaagaatgtcctaccttctttaccagatgctttgtggtattaaa
catctgcattcagctggtataattcatagagatttaaagcctagcaacattgttgtgaaa
tcagactgcaccctgaagatccttgactttggcctggcccggacagcgtgcactaacttc
atgatgaccccttatgtggtgacacggtactaccgggcgcccgaagtcatcctgggtatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgaccatattgatcagtggaataaagttattgagcag
ctgggaacaccatcagcagagttcatgaagaaacttcagccaactgtgaggaattatgtc
gaaaacagaccaaagtatcctggaatcaaattcgaagaactctttccagattggatattc
ccatcagaatctgagcgagacaaaataaaaacaagtcaagccagagatctgttatcaaaa
atgttagtgattgatcctgacaagcggatctctgtagatgaagctctgcgtcacccatac
atcactgtttggtatgaccctgccgaagcagaagccccaccacctcaaatttatgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagtc
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttctcagtcttcatcgatcaatgacatttcatccatgtcc
actgagcagacgctggcctcagacacagacagcagtcttgatgcctcgacgggacccctt
gaaggctgtcgatga

DBGET integrated database retrieval system