KEGG   Pan troglodytes (chimpanzee): 450810
Entry
450810            CDS       T01005                                 

Gene name
CTBP2
Definition
(RefSeq) C-terminal-binding protein 2 isoform X1
  KO
K04496  C-terminal binding protein
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04310  Wnt signaling pathway
ptr04330  Notch signaling pathway
ptr05200  Pathways in cancer
ptr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    450810 (CTBP2)
   04330 Notch signaling pathway
    450810 (CTBP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    450810 (CTBP2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    450810 (CTBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    450810 (CTBP2)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Macropinocytosis
   Others
    450810 (CTBP2)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Other DBs
NCBI-GeneID: 450810
NCBI-ProteinID: XP_009457738
VGNC: 51972
UniProt: A0A6D2XVX5 A0A2I3RSK0
LinkDB
Position
10
AA seq 513 aa
MRPGLPGPTGLCAQTSSSGQKSVPKEKESCGIWQLYHFHSRKREPRWEPCVSGSSSGDGA
VADLADELRGCPAFCCTLPVHSYRSWAGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILK
DLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVD
IKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVA
SGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDL
LYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRG
AALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPES
LRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIP
VTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgagaccaggacttccaggccccacagggttgtgcgctcagacctcaagtagcggccag
aagagtgtacccaaagagaaggaatcttgtggaatttggcagttgtaccattttcatagc
agaaaacgggagcccaggtgggagccatgtgtgtcgggttcctcgtcaggtgacggtgct
gttgcggatctcgcggatgagctgagggggtgtccagctttctgctgcacgcttcctgtc
cactcatacaggtcgtgggctggtatccgcccccagatcatgaacggccccctgcacccc
cgccccctggtggcgctgctggacggccgcgactgcactgtggagatgcccatcctgaag
gacctggccaccgtggccttctgtgacgcgcagtcgacgcaggaaatccacgagaaggtt
ctaaacgaagctgtgggcgccatgatgtaccacaccatcaccctcaccagggaggacctg
gagaagttcaaggccctgagagtgatcgtgcggataggcagtggctatgacaacgtggac
atcaaggctgccggcgagctcggaattgctgtgtgcaacatcccgtctgcagccgtggaa
gagacagcggactctaccatctgccacatcctcaatctgtaccggaggaacacgtggctg
taccaggcactgcgggaaggcacgcgggttcagagcgtggagcagatccgcgaggtggcc
tcgggagcggcccgcatccgtggggagacgctgggcctcattggctttggtcgcacgggg
caggcggttgcagttcgagccaaggcctttggattcagcgtcatattttatgacccctac
ttgcaggatgggatcgagcggtccctgggcgtgcagagggtctacaccctgcaggatttg
ctgtatcagagcgactgcgtctccttgcactgcaatctcaacgaacataaccaccacctc
atcaatgactttaccataaagcagatgaggcagggagcattccttgtgaacgcagcccgt
ggcggcctggtggacgagaaagccttagcacaagccctcaaggagggcaggatacgaggg
gcagccctcgacgtgcatgagtcagagcccttcagctttgctcagggtccgttgaaagat
gccccgaatctcatctgcactcctcacactgcctggtacagtgagcaggcgtcactggag
atgagggaggcagctgccaccgagatccgccgagccatcacaggtcgcatcccagaaagc
ttaagaaattgtgtgaacaaggaattctttgtcacatcagcgccttggtcagtaatagac
cagcaagcaattcatcctgagctcaatggtgccacatacagatatccgccaggcatcgtg
ggtgtggctccaggaggacttcctgcagccatggaagggatcatccctggaggcatccca
gtgactcacaacctcccgacagtggcacatccttcccaagcgccctctcccaaccagccc
acaaaacacggggacaatcgagagcaccccaacgagcaatag

KEGG   Pan troglodytes (chimpanzee): 738792
Entry
738792            CDS       T01005                                 

Gene name
CTBP1
Definition
(RefSeq) C-terminal-binding protein 1 isoform X3
  KO
K04496  C-terminal binding protein
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04310  Wnt signaling pathway
ptr04330  Notch signaling pathway
ptr05200  Pathways in cancer
ptr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    738792 (CTBP1)
   04330 Notch signaling pathway
    738792 (CTBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    738792 (CTBP1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    738792 (CTBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    738792 (CTBP1)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Macropinocytosis
   Others
    738792 (CTBP1)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 XdhC_C Cellsynth_D
Other DBs
NCBI-GeneID: 738792
NCBI-ProteinID: XP_016808214
Ensembl: ENSPTRG00000015827
VGNC: 2956
LinkDB
Position
4
AA seq 430 aa
MSGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAV
GALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADS
TLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVAL
RAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFT
VKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLI
CTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATHWASMDPAVVH
PELNGAAYSRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPE
ADRDHASDQL
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgtcaggcgtccgacctccgatcatgaacgggcccctgcacccgcggcccctggtggca
ttgctggatggccgggactgcacagtggagatgcccatcctgaaggacgtggccactgtg
gccttctgcgacgcgcagtccacgcaggagatccacgagaaggtcctgaacgaggctgtg
ggggccctgatgtaccacaccatcacgctcaccagggaggacctggagaagttcaaagcc
ctccgcatcatcgtccggattggcagtggttttgacaacatcgacatcaagtcggccggg
gatttaggcatcgccgtctgcaacgtgcctgcagcgtctgtggaggagacggccgactcg
acgctgtgccacatcctgaacctgtaccggcgggccacctggctgcaccaggcgctgcgg
gagggcacacgagtccagagcgtcgagcagatccgcgaggtggcgtccggcgccgccagg
atccgcggggagaccttgggcatcatcggacttggtcgcgtggggcaggcagtggcgctg
cgggccaaggccttcggcttcaatgtgctcttctacgacccttacttgtcggatggcgtg
gagcgggcgctggggctgcagcgtgtcagcaccctgcaggacctgctcttccacagcgac
tgcgtgaccctgcactgcggcctcaacgagcacaaccaccacctcatcaacgacttcacc
gtcaagcagatgagacaaggggccttcctggtgaacacagcccggggcggcctggtggac
gagaaggcgctggcccaggccctgaaggagggccggatccgcggcgcggccctggatgtg
cacgagtcggaacccttcagctttagccagggccccctgaaggatgcacccaacctcatc
tgcaccccccatgctgcatggtacagcgagcaggcgtccattgagatgcgagaggaggcg
gcacgggagatccgcagagccatcacaggccggatcccagacagcctgaagaactgtgtc
aacaaggaccatctgacagccgccacccactgggccagcatggaccctgccgtcgtgcac
cctgagctcaatggggctgcctatagcaggtaccctccgggcgtggtgggcgtggccccc
actggcatcccagctgctgtggaaggtatcgtccctagcgccatgtccctgtcccacggc
ctgccccctgtggcccacccgccccacgccccttctcctggccaaaccgtcaagcccgag
gcggatagagaccacgccagtgaccagttgtag

DBGET integrated database retrieval system