KEGG   Pan troglodytes (chimpanzee): 451690
Entry
451690            CDS       T01005                                 

Gene name
CBL
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL isoform X1
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04012  ErbB signaling pathway
ptr04120  Ubiquitin mediated proteolysis
ptr04144  Endocytosis
ptr04910  Insulin signaling pathway
ptr05100  Bacterial invasion of epithelial cells
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    451690 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    451690 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    451690 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    451690 (CBL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    451690 (CBL)
   05205 Proteoglycans in cancer
    451690 (CBL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    451690 (CBL)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    451690 (CBL)
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     451690 (CBL)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    451690 (CBL)
Ubiquitin system [BR:ptr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    451690 (CBL)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4 zf-RING_4
Other DBs
NCBI-GeneID: 451690
NCBI-ProteinID: XP_001165648
Ensembl: ENSPTRG00000004378
VGNC: 10188
UniProt: H2Q4Y2 A0A6D2XCW5
LinkDB
Position
11
AA seq 906 aa
MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCW
KLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFME
NLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFR
ITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFE
FDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRL
GQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDH
IKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVER
PPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLR
DLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPV
SAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPECD
HPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRAC
DCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPP
VPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSC
QQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISS
PAHVAT
NT seq 2721 nt   +upstreamnt  +downstreamnt
atggccggcaacgtgaagaagagctctggggccgggggcggcagcggctccgggggctcg
ggttcgggtggcctgattgggctcatgaaggacgccttccagccgcaccaccaccaccac
caccacctcagcccccacccgccggggacggtggacaagaagatggtggagaagtgctgg
aagctcatggacaaggtggtgcggttgtgtcagaacccaaagctggcgctaaagaatagc
ccaccttatatcttagacctgctaccagatacctaccagcatctccgtactatcttgtca
agatatgaggggaagatggagacacttggagaaaatgagtattttagggtgtttatggag
aatttgatgaagaaaactaagcaaaccataagcctcttcaaggagggaaaagaaagaatg
tatgaggagaattctcagcctaggcgaaacctaaccaaactgtccctcatcttcagccac
atgctggcagaactaaaaggaatctttccaagtggactctttcagggagacacatttcgg
attactaaagcagatgctgcggaattttggagaaaagcttttggggaaaagacgatagtc
ccttggaagagctttcgacaggctctacatgaagtgcatcccatcagttctgggctggag
gccatggctctgaaatccactattgatctgacctgcaatgattatatttcggtttttgaa
tttgacatctttacccgactctttcagccctggtcctctttgctcaggaattggaacagc
ctcgctgtaactcatcctggctacatggcttttttgacgtatgacgaagtgaaagctcgg
ctccagaaattcattcacaaacctggcagttatatcttccggctgagctgtactcgtctg
ggtcagtgggctattgggtatgttactgctgatgggaacattctccagacaatccctcac
aataaacctctcttccaagcactgattgatggcttcagggaaggcttctatttgtttcct
gatggacgaaatcagaatcctgatctgactggcttatgtgaaccaactccccaagaccat
atcaaagtgacccaggaacaatatgaattatactgtgagatgggctccacattccaacta
tgtaaaatatgtgctgaaaatgataaggatgtaaagattgagccctgtggacacctcatg
tgcacatcctgtcttacatcctggcaggaatcagaaggtcagggctgtcctttctgccga
tgtgaaattaaaggtactgaacccatcgtggtagatccgtttgatcctagagggagtggc
agcctgttgaggcaaggagcagagggagctccctccccaaattacgatgatgatgatgat
gaacgagctgatgatactctcttcatgatgaaggaattggctggtgccaaggtggaacgg
ccgccttctccattctccatggccccacaagcttcccttcccccggtgccaccacgactt
gaccttctgccgcagcgagtatgtgttccctcaagtgcttctgctcttggaactgcttct
aaggctgcttctggctcccttcataaagacaaaccattgccagtacctcccacacttcga
gatcttccaccaccaccgcctccagaccggccatattctgttggagcagaatcccgacct
caaagacgccccttgccttgtacaccaggcgactgtccctccagagacaaactgccccct
gtcccctctagccgccttggagactcatggctgccccggccaatccccaaagtaccagta
tctgccccaagttccagtgatccctggacaggaagagaattaaccaaccggcactcactt
ccattttcattgccctcacaaatggagcccagaccagatgtgcctaggcttggaagcacg
ttcagtctggatacctccatgagtatgaatagcagcccattagtaggtccagagtgtgac
caccccaaaatcaaaccttcctcatctgccaatgccatttattctctggctgccagacct
cttcctgtgccaaaactgccacctggggagcaatgtgagggtgaagaggacacagagtac
atgactccctcctccaggcctctacggcctttggatacatcccagagttcacgagcatgt
gattgcgaccagcagattgatagctgtacgtatgaagcaatgtataatattcagtcccag
gcgccatctatcaccgagagcagcacctttggtgaagggaatttggccgcagcccatgcc
aacactggtcccgaggagtcagaaaatgaggatgatgggtatgatgtcccaaagccacct
gtgccggccgtgctggcccgccgaactctctcagatatctctaatgccagctcctccttt
ggctggttgtctctggatggtgatcctacaacaaatgtcactgaaggttcccaagttccc
gagaggcctccaaaaccattccctcggagaatcaactctgaacggaaagctggcagctgt
cagcaaggtagtggtcctgccgcctctgctgccaccgcctcacctcagctctccagtgag
atcgagaacctcatgagtcaggggtactcctaccaggacatccagaaagctttggtcatt
gcccagaacaacatcgagatggccaaaaacatcctccgggaatttgtttccatttcttct
cctgcccatgtagctacctag

DBGET integrated database retrieval system