KEGG   Pan troglodytes (chimpanzee): 454679
Entry
454679            CDS       T01005                                 

Gene name
STAT5B
Definition
(RefSeq) signal transducer and activator of transcription 5B isoform X1
  KO
K11224  signal transducer and activator of transcription 5B
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04012  ErbB signaling pathway
ptr04062  Chemokine signaling pathway
ptr04217  Necroptosis
ptr04630  JAK-STAT signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04917  Prolactin signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr05161  Hepatitis B
ptr05162  Measles
ptr05166  Human T-cell leukemia virus 1 infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    454679 (STAT5B)
   04630 JAK-STAT signaling pathway
    454679 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    454679 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    454679 (STAT5B)
   04659 Th17 cell differentiation
    454679 (STAT5B)
   04062 Chemokine signaling pathway
    454679 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    454679 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    454679 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    454679 (STAT5B)
   05203 Viral carcinogenesis
    454679 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    454679 (STAT5B)
   05220 Chronic myeloid leukemia
    454679 (STAT5B)
   05223 Non-small cell lung cancer
    454679 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    454679 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    454679 (STAT5B)
   05161 Hepatitis B
    454679 (STAT5B)
   05162 Measles
    454679 (STAT5B)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    454679 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 454679
NCBI-ProteinID: XP_024206064
Ensembl: ENSPTRG00000009198
VGNC: 12700
LinkDB
Position
17
AA seq 787 aa
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGG
GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagctcagcagctccaaggagaagcccttcatcagatgcaagcg
ttatatggccagcattttcccattgaggtgcggcattatttatcccagtggattgaaagc
caagcatgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcagagcaccaggtgggggaagatggg
tttttactgaagatcaagctggggcactatgccacgcagctccagaacacgtatgaccgc
tgccccatggagctggtccgctgcatccgccatatattgtacaatgaacagaggttggtc
cgagaagccaacaatggtagctctccagctggaagccttgctgatgccatgtcccagaaa
cacctccagatcaaccagacgtttgaggagctgcgactggtcacgcaggacacagagaat
gagttaaaaaagctgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagctcagtttggcccgctggcccagctgagcccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtctctggaggcctggttgcagcgtgaggcacag
acactgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggccgggaatggcgggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatccccggcccagtggaggagatgctggccgaggtcaacgccaccatc
acggacattatctcagccctggtgaccagcacattcatcattgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcagccactgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgctcaagaacgagaacacccgcaatgattacagtggcgagatcttgaacaactgc
tgcgtcatggagtaccaccaagccacaggcacccttagtgcccacttcaggaatatgtcc
ctgaaacgaattaagaggtcagaccgtcgtggggcagagtcggtgacagaagaaaaattt
acaatcctgtttgaatcccagttcagtgttggtggaaatgagctggtttttcaagtcaag
accctgtccctgccagtggtggtgatcgttcatggcagccaggacaacaatgcgacggcc
accgttctctgggacaatgcttttgcagagcctggcagggtgccatttgccgtgcctgac
aaagtgctgtggccacagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctagcacagaaactgttcaacaac
agtagcagccacctggaggactacagtggcctgtctgtgtcctggtcccagttcaacagg
gagaatttaccaggacggaattacactttctggcaatggtttgacggtgtgatggaagtg
ttaaaaaaacatctcaagcctcattggaatgatggggccattttggggtttgtaaacaag
caacaggcccatgacctactcattaacaagccagatgggaccttcctcctgagattcagt
gactcagaaattggcggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagacttctccattcggtccctagccgaccgcttg
ggagacttgaattaccttatctacgtgtttcctgatcggccaaaagatgaagtatactcc
aaatactacacaccagttccctgcgagtctgctactgctaaagctgttgatggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgaacgcatctgcagatgccgggggt
ggcagcgccacgtacatggaccaggccccctccccagctgtgtgtccccaggctcactat
aacatgtacccacagaaccctgactcagtccttgacaccgatggggacttcgatctggag
gacacaatggacgtagcgcggcgtgtggaggagctcctgggccggccaatggacagtcag
tggatcccgcacgcacaatcgtga

KEGG   Pan troglodytes (chimpanzee): 454681
Entry
454681            CDS       T01005                                 

Gene name
STAT5A
Definition
(RefSeq) signal transducer and activator of transcription 5A isoform X1
  KO
K11223  signal transducer and activator of transcription 5A
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04012  ErbB signaling pathway
ptr04217  Necroptosis
ptr04630  JAK-STAT signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04917  Prolactin signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr05161  Hepatitis B
ptr05162  Measles
ptr05166  Human T-cell leukemia virus 1 infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    454681 (STAT5A)
   04630 JAK-STAT signaling pathway
    454681 (STAT5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    454681 (STAT5A)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    454681 (STAT5A)
   04659 Th17 cell differentiation
    454681 (STAT5A)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    454681 (STAT5A)
   04935 Growth hormone synthesis, secretion and action
    454681 (STAT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    454681 (STAT5A)
   05203 Viral carcinogenesis
    454681 (STAT5A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    454681 (STAT5A)
   05220 Chronic myeloid leukemia
    454681 (STAT5A)
   05223 Non-small cell lung cancer
    454681 (STAT5A)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    454681 (STAT5A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    454681 (STAT5A)
   05161 Hepatitis B
    454681 (STAT5A)
   05162 Measles
    454681 (STAT5A)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    454681 (STAT5A)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 454681
NCBI-ProteinID: XP_024206061
Ensembl: ENSPTRG00000009199
VGNC: 9664
LinkDB
Position
17
AA seq 794 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPMELVRCIRHILYNEQRLV
REANNCSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATY
MDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLS
PPAGLFTSARGSLS
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagacgcgctgcgccagatgcaggtg
ctgtacggccagcacttccccatcgaggtccggcactacttggcccagtggattgagagc
cagccatgggatgccattgacttggacaatccccaggacagagcccaagccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaggtgggggaagatggg
tttttactgaagatcaagctggggcactacgccacgcagctccagaaaacatatgaccgc
tgccccatggagctggtccgctgcatccggcacattctgtacaatgaacagaggctggtc
cgagaagccaacaattgcagctctccggctgggatcctggttgacgccatgtcccagaag
caccttcagatcaaccagacatttgaggagctgcgactggtcacgcaggacacggagaat
gagctgaagaagctgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagctcagtttgcccagctggcccagctgagcccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtctctggaggcctggttgcagcgtgaggcacag
acactgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggccgggaatggcgggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatccccggcccagtggaggagatgctggccgaggtcaacgccaccatc
acggacattatctcagccctggtgaccagcacattcatcattgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcagccaccgtacgcctgctggtgggcgggaagctg
aacgtgcacatgaatcccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgctcaaaaatgagaacacccgcaacgagtgcagtggtgagatcctgaacaactgc
tgcgtgatggagtaccaccaagccacgggcaccctcagtgcccacttcaggaacatgtca
ctgaagaggatcaagcgtgctgaccggcggggtgcagagtccgtgacagaggagaagttc
acagtcctgtttgagtctcagttcagtgttggcagcaatgagcttgtgttccaggtgaag
actctgtccctacctgtggttgtcatcgtccacggcagccaggaccacaatgccacggct
accgtgctgtgggacaacgcctttgctgagccgggcagggtgccatttgccgtgcctgac
aaagtgctgtggccgcagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctagcacagaaactgttcaacaac
agcagcagccacctggaggactacagtggcctgtccgtgtcctggtcccagttcaacagg
gagaacttgccgggctggaactacaccttctggcagtggtttgacggggtgatggaggtg
ttgaagaagcaccacaagccccactggaatgatggggccatcctaggttttgtgaataag
caacaggcccacgacctgctcatcaacaagcccgatgggaccttcttgttgcgctttagt
gactcagaaatcgggggcatcaccatcgcctggaagtttgactccccggaacgcaacctg
tggaacctgaaaccattcaccacgcgggatttctccatcaggtccctggctgaccggctg
ggggacctgagctatctcatctatgtgtttcctgaccgccccaaggatgaggtcttctcc
aagtactacactcctgtgctggctaaagctgttgatggatatgtgaaaccacagatcaag
caagtggtccctgagtttgtgaacgcatctgcagatgctgggggcagcagcgccacgtac
atggaccaggccccctccccagctgtgtgcccccaggctccctataacatgtacccacag
aaccctgaccatgtactcgatcaggatggagaattcgacctggatgagaccatggatgtg
gccaggcacgtggaggaactcttacgccgaccaatggacagtcttgactcccgcctctcg
ccccctgccggtcttttcacctctgccagaggctccctctcatga

DBGET integrated database retrieval system