KEGG   Pan troglodytes (chimpanzee): 455647
Entry
455647            CDS       T01005                                 

Gene name
VAV1
Definition
(RefSeq) proto-oncogene vav isoform X1
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04510  Focal adhesion
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04670  Leukocyte transendothelial migration
ptr04810  Regulation of actin cytoskeleton
ptr05135  Yersinia infection
ptr05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    455647 (VAV1)
   04024 cAMP signaling pathway
    455647 (VAV1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    455647 (VAV1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    455647 (VAV1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    455647 (VAV1)
   04660 T cell receptor signaling pathway
    455647 (VAV1)
   04662 B cell receptor signaling pathway
    455647 (VAV1)
   04664 Fc epsilon RI signaling pathway
    455647 (VAV1)
   04666 Fc gamma R-mediated phagocytosis
    455647 (VAV1)
   04670 Leukocyte transendothelial migration
    455647 (VAV1)
   04062 Chemokine signaling pathway
    455647 (VAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    455647 (VAV1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    455647 (VAV1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ptr04990]
    455647 (VAV1)
Domain-containing proteins not elsewhere classified [BR:ptr04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   455647 (VAV1)
SSDB
Motif
Pfam: RhoGEF SH3_1 SH3_2 CAMSAP_CH CH SH2 SH3_9 C1_1 PH CDC24 C1_2 DUF3104 LZ3wCH PH_16
Other DBs
NCBI-GeneID: 455647
NCBI-ProteinID: XP_016790329
Ensembl: ENSPTRG00000010378
VGNC: 2419
UniProt: A0A6D2X6C5 H2QF58
LinkDB
Position
19
AA seq 845 aa
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVF
QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED
YSEYC
NT seq 2538 nt   +upstreamnt  +downstreamnt
atggagctgtggcgccaatgcacccactggctcatccagtgccgggtgctgccgcccagc
caccgcgtgacctgggatggggctcaggtgtgtgaactggcccaggccctccgggatggt
gtccttctgtgtcagctgcttaacaacctgctaccccatgccatcaacctgcgtgaggtc
aacctgcgcccccagatgtcccagttcctgtgccttaagaacattagaaccttcctgtcc
acctgctgtgagaaattcggcctcaagcggagcgagctcttcgaagcctttgacctcttc
gatgtgcaggattttggcaaggtcatctacaccctgtctgctctgtcctggaccccgatc
gcccagaacagggggatcatgcccttccccaccgaggaggagagtgtaggtgatgaagac
atctacagtggcctgtccgaccagatcgacgacacggtggaggaggatgaggacctgtat
gactgcgtggagaatgaggaggcggaaggcgacgagatctatgaggacctcatgcgctcg
gagcccgtgtccatgccgcccaagatgacagagtatgacaagcgctgctgctgcctgcgg
gagatccagcagacggaggagaagtacactgacacgctgggctccatccagcagcatttc
ttgaagcccctgcaacggttcctgaaacctcaagacattgagatcatctttatcaacatt
gaggacctgcttcgtgttcatactcacttcctaaaggagatgaaggaagccctgggcacc
cctggcgcagccaatctctaccaggtcttcatcaaatacaaggagaggttccttgtctat
ggccgctactgcagccaggtggagtcagccagcaaacacctggaccgtgtggccgcagcc
cgggaggacgtgcagatgaagctggaggaatgttctcagagagccaacaacgggaggttc
accctgcgggacctgctgatggtgcctatgcagcgagttctcaaatatcacctccttctc
caggagctggtgaaacacacgcaggaggcgatggagaaggagaacctgcggctggccctg
gatgccatgagggacctggctcagtgcgtgaacgaggtcaagcgagacaacgagacactg
cggcagatcaccaatttccagctgtccattgagaacctggaccagtctctggctcactat
ggccggcccaagatcgacggggaactcaagatcacctcggtggaacggcgctccaagatg
gacaggtatgccttcctgctcgacaaagctctactcatctgtaagcgccggggagactcc
tatgacctcaaggactttgtaaacctgcacagcttccaggttcgggacgactcttcagga
gaccgagataacaagaagtggagccacatgttcctcctgatcgaggaccaaggtgcccag
ggctatgagctgttcttcaagacaagagaattgaagaagaagtggatggagcagtttgag
atggccatctccaacatctatccggagaatgccaccgccaacgggcatgacttccagatg
ttctcctttgaggagaccacgtcctgcaaggcctgtcagatgctgcttagaggtaccttc
tatcagggctaccgctgccatcggtgccgggcatctgcacacaaggagtgtctggggagg
gtccctccatgtggccgacatgggcaagatttcccaggaactatgaagaaggacaaacta
catcgcagggctcaggacaaaaagaggaatgagctgggtctgcccaagatggaggtgttt
caggaatactacgggcttcctccaccccctggagccattggaccctttctacggctcaac
cctggagacattgtggagctcacgaaggctgaggctgaacagaactggtgggagggcaga
aatacatctactaatgaaattggctggtttccttgtaacagggtgaagccctatgtccat
ggccctcctcaggacctgtctgttcatctctggtacgcaggccccatggagcgggcaggg
gcagagagcatcctggccaaccgctcggacgggactttcttggtgcggcagagggtgaag
gatgcagcagaatttgccatcagcattaaatataacgtcgaggtcaagcacattaaaatc
atgacagcagaaggactgtaccggatcacagagaaaaaggctttccgggggcttacggag
ctggtggagttttaccagcagaactctctaaaggattgcttcaagtctctggacaccacc
ttgcagttccccttcaaggagcctgagaagagaaccatcagcaggccagcagtgggaagc
acaaagtattttggcacagccaaagcccgctatgacttctgcgcccgagaccgatcagag
ctgtcgctcaaggagggtgacatcatcaagatccttaacaagaagggacagcaaggctgg
tggcgaggggagatctatggccgggttggctggttccctgccaactacgtggaggaagat
tattctgaatactgctga

KEGG   Pan troglodytes (chimpanzee): 457076
Entry
457076            CDS       T01005                                 

Gene name
VAV3
Definition
(RefSeq) guanine nucleotide exchange factor VAV3 isoform X1
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04510  Focal adhesion
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04670  Leukocyte transendothelial migration
ptr04810  Regulation of actin cytoskeleton
ptr05135  Yersinia infection
ptr05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    457076 (VAV3)
   04024 cAMP signaling pathway
    457076 (VAV3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    457076 (VAV3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    457076 (VAV3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    457076 (VAV3)
   04660 T cell receptor signaling pathway
    457076 (VAV3)
   04662 B cell receptor signaling pathway
    457076 (VAV3)
   04664 Fc epsilon RI signaling pathway
    457076 (VAV3)
   04666 Fc gamma R-mediated phagocytosis
    457076 (VAV3)
   04670 Leukocyte transendothelial migration
    457076 (VAV3)
   04062 Chemokine signaling pathway
    457076 (VAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    457076 (VAV3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    457076 (VAV3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ptr04990]
    457076 (VAV3)
Domain-containing proteins not elsewhere classified [BR:ptr04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   457076 (VAV3)
SSDB
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_9 SH3_1 SH2 C1_1 PH CDC24 Filamin PH_16 PH_10 LZ3wCH Prok-RING_1 Zn_ribbon_17 C1_2 zf-RING-like
Other DBs
NCBI-GeneID: 457076
NCBI-ProteinID: XP_016779088
Ensembl: ENSPTRG00000001024
VGNC: 1722
UniProt: A0A2I3REC5
LinkDB
Position
1
AA seq 875 aa
MEPWKQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESINDEDIYKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAE
EAHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDSTEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVI
RNYSGTPPPALHEGPPLHLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRA
GNSSPSLFCGFSFVTPPDYSFVPPSSTPFWSVLSPKVLGIAIARYDFCARDMRELSLLKG
DVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE
NT seq 2628 nt   +upstreamnt  +downstreamnt
atggagccgtggaagcagtgcgcgcagtggctcatccattgcaaggtgctgcccgccaac
caccgggtgacctgggactcggctcaggtgttcgacctggcgcagaccctccgcgatgga
gtcctgctctgccagctgcttaacaacctccgggcgcactccatcaacctgaaggagatc
aacctgaggccgcagatgtcccagtttctctgtttgaagaacataaggacatttctcacg
gcctgttgtgagacgtttggaatgaggaaaagtgaacttttcgaggcatttgacctgttt
gatgttcgtgactttggaaaggttatagaaacattatcacgactttctcgaacacctata
gcattggccacaggaatcaggcccttcccaacagaagaaagcattaatgatgaagacatc
tacaaaggccttcctgatttaatagatgaaacccttgtggaagatgaagaagatctctat
gactgtgtttatggggaagatgaaggtggagaagtctatgaggacttaatgaaggcagag
gaagcacatcagcccaaatgtccagaaaatgatatacgaagttgttgtctagcagaaatt
aagcagacagaagaaaaatatacagaaactttggagtcaatagaaaaatatttcatggca
ccactaaaaagatttctgacagcagcagaatttgattcagtattcatcaacattcctgaa
cttgtaaaacttcatcggaacctaatgcaagagattcatgattccattgtaaataaaaat
gaccagaacttgtaccaagtttttattaactacaaggaaagattggttatttacgggcag
tactgcagtggagtggagtcagccatctctagtttagactacatttctaagacaaaagaa
gatgtcaaactgaaattagaggaatgttccaaaagagcaaataatgggaaatttacactt
cgagacttgcttgtggttcctatgcaacgtgttttaaagtaccaccttctcctccaggaa
ctggtcaaacataccactgattcgactgagaaggcaaatctgaaactggctcttgatgcc
atgaaggacttggcacaatatgtgaatgaagtgaaaagagataatgagacccttcgtgaa
attaaacagtttcagctatctatagagaatttgaaccaaccagttttgctttttggacga
cctcagggagatggtgaaattcgaataaccactctagacaagcataccaaacaagaaagg
catatcttcttatttgatttggcagtgatcgtatgtaagagaaaaggtgataactatgaa
atgaaggaaataatagatcttcagcagtacaagatagccaataatcctacaaccgataaa
gaaaataaaaagtggtcttatggcttctacctcatccatacccaaggacaaaatgggtta
gaattttattgcaaaacaaaagatttaaagaagaaatggctagaacagtttgaaatggct
ttgtctaacataaggccagactatgcagactccaatttccacgacttcaagatgcatacc
ttcactcgagtcacatcctgcaaagtctgccagatgctcctgaggggaacattttatcaa
ggctatttatgttttaagtgtggagcgagagcacacaaagaatgtttgggaagagtagac
aattgtggcagagttaattctggtgaacaagggacactcaaactaccagagaaacggacc
aatggactgcgaagaactcctaaacaggtggatccaggtttaccaaagatgcaggtcatt
aggaactattctggaacaccacccccagctctgcatgaaggaccccctttacacctccag
gccggggataccgttgaacttctgaaaggagatgcacacagtctgttttggcagggcaga
aatttggcatctggagaggttggattttttccaagtgatgcagtcaagccttgcccatgt
gtgcccaaaccagtagattattcttgccaaccctggtatgctggagcaatggaaagattg
caagcagagactgaacttattaacagggtaaatagtacttaccttgtgaggcacaggacc
aaagagtcaggagaatatgcaattagcattaagtacaataatgaagcaaagcacatcaag
attttaacaagagatggtttttttcacattgcagaaaatagaaaatttaaaagtttaatg
gaacttgtggagtactacaagcatcattctctcaaggaagggttcagaaccttagataca
actctgcagtttccatacaaggagccagaacattcagctggacagaggggtaatagagca
ggcaacagctccccctctttgttctgtggcttttcttttgtaactcctccagactacagc
tttgttcccccttcttccactcctttctggtcagtgttaagtccaaaagtgctgggcatt
gccatcgctcggtatgacttctgtgcaagagatatgagagagttgtccttgttgaaagga
gatgtggtgaagatttacacaaagatgagtgcaaatggctggtggagaggagaagtaaat
ggcagggtgggctggtttccatccacatatgtggaagaggatgaataa

KEGG   Pan troglodytes (chimpanzee): 473114
Entry
473114            CDS       T01005                                 

Gene name
VAV2
Definition
(RefSeq) guanine nucleotide exchange factor VAV2 isoform X1
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04510  Focal adhesion
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04670  Leukocyte transendothelial migration
ptr04810  Regulation of actin cytoskeleton
ptr05135  Yersinia infection
ptr05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    473114 (VAV2)
   04024 cAMP signaling pathway
    473114 (VAV2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    473114 (VAV2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    473114 (VAV2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    473114 (VAV2)
   04660 T cell receptor signaling pathway
    473114 (VAV2)
   04662 B cell receptor signaling pathway
    473114 (VAV2)
   04664 Fc epsilon RI signaling pathway
    473114 (VAV2)
   04666 Fc gamma R-mediated phagocytosis
    473114 (VAV2)
   04670 Leukocyte transendothelial migration
    473114 (VAV2)
   04062 Chemokine signaling pathway
    473114 (VAV2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    473114 (VAV2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    473114 (VAV2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ptr04990]
    473114 (VAV2)
Domain-containing proteins not elsewhere classified [BR:ptr04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   473114 (VAV2)
SSDB
Motif
Pfam: RhoGEF CAMSAP_CH SH3_2 CH SH3_1 SH3_9 SH2 C1_1 PH CDC24 PLU-1 C1_2 PH_10 SH2_2 Zn_ribbon_17 zf-RING-like
Other DBs
NCBI-GeneID: 473114
NCBI-ProteinID: XP_016817513
Ensembl: ENSPTRG00000021525
VGNC: 4899
LinkDB
Position
9
AA seq 896 aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAV
FINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQL
LASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLK
EALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNH
TKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKQAGFPLPSHPA
VLGGGLWSHGKMWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANAN
HHSFQMYTFDKTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDA
SGAGPGPKMVAVQNYHGNPAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYF
PSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPA
EAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTT
LKYPYKSRERSASRASSRSPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAV
ARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ
NT seq 2691 nt   +upstreamnt  +downstreamnt
atggagcagtggcggcagtgcggccgctggctcatcgactgcaaggtcctgccgcccaac
caccgggtggtgtggccctcggccgtggtcttcgacctggcgcaggcgctgcgcgacggg
gtccttctgtgccagctgctgcacaacctctcccccggctccatcgacctcaaggacatc
aacttccggccgcagatgtcccagtttctgtgtttgaagaacatacgcaccttcctgaaa
gtctgccacgataaattcggattaaggaacagcgagctgtttgacccctttgacctcttc
gatgtgcgagacttcggaaaggtcatctccgcggtgtcgaggctctccctgcacagcatc
gcgcagaacaaaggcatcaggccttttccctcagaggagaccacagagaatgacgatgac
gtctaccgcagcctggaggagctggccgatgagcatgacctgggggaggacatctacgac
tgcgtcccgtgtgaagatggaggggatgacatctatgaggacatcatcaaggtggaggtg
cagcagcccatgattagatacatgcagaaaatgggcatgactgaggatgacaagaggaac
tgctgcctgctggagatccaggagaccgaggccaagtactaccgcaccctggaggacatt
gagaagaactacatgagccccctgcggctggtgctgagcccggcggacatggcagctgtc
ttcattaacctggaggacctgatcaaggtgcatcacagcttcctgagggccatcgacgtg
tccgtgatggttgggggcagcacgctggccaaggtcttcctcgatttcaaggaaaggctc
ctgatctacggggagtactgcagccacatggagcacgcccagaacacactgaaccagctc
ctggccagccgggaggacttcaggcagaaagtcgaggagtgcacgctgaaggtccaggat
ggaaaatttaagctgcaagacctgctggtggtccccatgcagagggtgctcaaataccac
ctgctcttgaaggagcttctgagccattctgcggaacggcctgagaggcagcagctcaaa
gaagcactggaagccatgcaggacttggcgatgtacatcaatgaagttaaacgggacaag
gagaccttgaggaaaatcagcgaatttcagagttctatagaaaatttgcaagtgaaactg
gaggaatttggaagaccaaagattgacggggaactgaaagtccggtccatagtcaaccac
accaagcaggacaggtacttgttcctgtttgacaaggtggtcatcgtctgcaagcggaag
ggctacagctacgagctcaaggagatcatcgagctgctgttccacaagatgaccgacgac
cccatgaacaacaaggacgtcaagaagcaagcaggctttcctctcccgtcccaccctgcg
gtgcttggaggagggctgtggtctcacgggaaaatgtggtcctacggcttctacctaatt
caccttcaaggaaagcagggcttccagtttttctgcaaaacagaagatatgaagaggaag
tggatggagcagtttgagatggccatgtcaaacatcaagccagacaaagccaatgccaac
caccacagtttccagatgtacacgtttgacaagaccaccaactgcaaagcctgcaaaatg
ttcctcaggggcaccttctaccagggatacatgtgtaccaagtgtggcgtcggggcacac
aaggagtgcctggaagtgatacctccctgcaagttcacttctcctgcagatctggacgcc
tccggagcgggaccaggtcccaagatggtggccgtgcagaattaccatggcaacccagcc
cctcccgggaagcctgtgctgaccttccagacgggcgacgtgcttgagctgctgaggggc
gaccctgagtctccgtggtgggagggtcgtctggtgcaaaccaggaagtcagggtatttc
cccagctcatctgtgaagccctgccctgtggatggaaggccgcccatcagccggccgcca
tcccgggagattgactacactgcatacccctggtttgcaggtaacatggagaggcagcag
acggacaacctgctcaagtcccacgccagtgggacctacctgatcagggagcggcctgcc
gaggctgagcgctttgcaataagcatcaagttcaatgacgaggtgaagcacatcaaggtg
gtggagaaggacaactggatccacatcacagaggccaagaaattcgacagcctcctggag
ttggtggagtactaccagtgccactcactgaaggagagcttcaagcagctggacaccaca
ctcaagtacccctacaagtcccgggaacgttcggcctccagggcctccagccggtcccca
gcttcctgtgcttcctacaacttttcttttctcagtcctcagggcctcagctttgcttct
cagggcccctccgctcccttctggtcagtgttcacgccgcgcgtcatcggcacggctgtg
gccagatacaactttgccgcccgagacatgagggagctttcgctgcgggagggtgacgtg
gtgaggatctacagccgcatcggcggagaccagggctggtggaagggcgagaccaatgga
cggattggctggtttccttcaacgtacgtagaagaggagggtatccagtga

DBGET integrated database retrieval system