KEGG   Pan troglodytes (chimpanzee): 456929
Entry
456929            CDS       T01005                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha isoform X2
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
ptr04115  p53 signaling pathway
ptr04210  Apoptosis
ptr04218  Cellular senescence
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05216  Thyroid cancer
ptr05217  Basal cell carcinoma
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    456929 (GADD45A)
   04064 NF-kappa B signaling pathway
    456929 (GADD45A)
   04068 FoxO signaling pathway
    456929 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    456929 (GADD45A)
   04210 Apoptosis
    456929 (GADD45A)
   04115 p53 signaling pathway
    456929 (GADD45A)
   04218 Cellular senescence
    456929 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    456929 (GADD45A)
   05202 Transcriptional misregulation in cancer
    456929 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    456929 (GADD45A)
   05212 Pancreatic cancer
    456929 (GADD45A)
   05225 Hepatocellular carcinoma
    456929 (GADD45A)
   05226 Gastric cancer
    456929 (GADD45A)
   05214 Glioma
    456929 (GADD45A)
   05216 Thyroid cancer
    456929 (GADD45A)
   05220 Chronic myeloid leukemia
    456929 (GADD45A)
   05217 Basal cell carcinoma
    456929 (GADD45A)
   05218 Melanoma
    456929 (GADD45A)
   05213 Endometrial cancer
    456929 (GADD45A)
   05224 Breast cancer
    456929 (GADD45A)
   05222 Small cell lung cancer
    456929 (GADD45A)
   05223 Non-small cell lung cancer
    456929 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    456929 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptr03036]
    456929 (GADD45A)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     456929 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     456929 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae XPA_C
Other DBs
NCBI-GeneID: 456929
NCBI-ProteinID: XP_001164496
Ensembl: ENSPTRG00000000842
VGNC: 6828
UniProt: A0A6D2XNY8 A0A2I3SRT0
LinkDB
Position
1
AA seq 131 aa
MTLEEFSAGEQKTESDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSN
PGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMD
QWVPVINLPER
NT seq 396 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaagcgaccccgataacgtg
gtgttgtgcctgctggcggcggacgaggacgacgacagagatgtggctctgcagatccac
ttcaccctgatccaggcgttttgctgcgagaacgacatcaacatcctgcgcgtcagcaac
ccgggccggctggcggagctcctgctcttggagaccgacgctggccccgcggcgagcgag
ggcgccgagcagcccccggacctgcactgcgtgctggtgacgaatccacattcatctcaa
tggaaggatcctgccttaagtcaacttatttgtttttgccgggaaagtcgctacatggat
caatgggttccagtgattaatctccctgaacggtga

KEGG   Pan troglodytes (chimpanzee): 464585
Entry
464585            CDS       T01005                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
ptr04115  p53 signaling pathway
ptr04210  Apoptosis
ptr04218  Cellular senescence
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05216  Thyroid cancer
ptr05217  Basal cell carcinoma
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    464585 (GADD45G)
   04064 NF-kappa B signaling pathway
    464585 (GADD45G)
   04068 FoxO signaling pathway
    464585 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    464585 (GADD45G)
   04210 Apoptosis
    464585 (GADD45G)
   04115 p53 signaling pathway
    464585 (GADD45G)
   04218 Cellular senescence
    464585 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    464585 (GADD45G)
   05202 Transcriptional misregulation in cancer
    464585 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    464585 (GADD45G)
   05212 Pancreatic cancer
    464585 (GADD45G)
   05225 Hepatocellular carcinoma
    464585 (GADD45G)
   05226 Gastric cancer
    464585 (GADD45G)
   05214 Glioma
    464585 (GADD45G)
   05216 Thyroid cancer
    464585 (GADD45G)
   05220 Chronic myeloid leukemia
    464585 (GADD45G)
   05217 Basal cell carcinoma
    464585 (GADD45G)
   05218 Melanoma
    464585 (GADD45G)
   05213 Endometrial cancer
    464585 (GADD45G)
   05224 Breast cancer
    464585 (GADD45G)
   05222 Small cell lung cancer
    464585 (GADD45G)
   05223 Non-small cell lung cancer
    464585 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    464585 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptr03036]
    464585 (GADD45G)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     464585 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     464585 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 464585
NCBI-ProteinID: XP_001141972
Ensembl: ENSPTRG00000021095
VGNC: 4748
UniProt: H2QXF6 A0A6D2X4W5
LinkDB
Position
9
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggacacagttccggaaagcacagccaggatgcag
ggtgccgggaaagcgctgcacgagttgctgctgtcggcgcagcgtcagggctgcctcact
gccggcgtctacgagtcagccaaagtcttgaacgtggaccccgacaatgtgaccttctgt
gtgctggctgcggatgaggaggacgagggcgacatcgcgctgcagatccattttacgctg
atccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcgg
ctggcggctatcgtgggcgccggcgaggaggcgggtgcgccgggcgacctgcactgcatc
ctcatttcgaaccccaacgaggacgcctggaaggatcccgccttggagaagctcagcctg
ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga

KEGG   Pan troglodytes (chimpanzee): 744311
Entry
744311            CDS       T01005                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
ptr04115  p53 signaling pathway
ptr04210  Apoptosis
ptr04218  Cellular senescence
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05216  Thyroid cancer
ptr05217  Basal cell carcinoma
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    744311 (GADD45B)
   04064 NF-kappa B signaling pathway
    744311 (GADD45B)
   04068 FoxO signaling pathway
    744311 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    744311 (GADD45B)
   04210 Apoptosis
    744311 (GADD45B)
   04115 p53 signaling pathway
    744311 (GADD45B)
   04218 Cellular senescence
    744311 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    744311 (GADD45B)
   05202 Transcriptional misregulation in cancer
    744311 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    744311 (GADD45B)
   05212 Pancreatic cancer
    744311 (GADD45B)
   05225 Hepatocellular carcinoma
    744311 (GADD45B)
   05226 Gastric cancer
    744311 (GADD45B)
   05214 Glioma
    744311 (GADD45B)
   05216 Thyroid cancer
    744311 (GADD45B)
   05220 Chronic myeloid leukemia
    744311 (GADD45B)
   05217 Basal cell carcinoma
    744311 (GADD45B)
   05218 Melanoma
    744311 (GADD45B)
   05213 Endometrial cancer
    744311 (GADD45B)
   05224 Breast cancer
    744311 (GADD45B)
   05222 Small cell lung cancer
    744311 (GADD45B)
   05223 Non-small cell lung cancer
    744311 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    744311 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptr03036]
    744311 (GADD45B)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     744311 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     744311 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 744311
NCBI-ProteinID: XP_001151983
Ensembl: ENSPTRG00000024024
VGNC: 14745
UniProt: H2R6I0 A0A6D2X465
LinkDB
Position
19
AA seq 160 aa
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgacc
gccgcggtggaggagcttttggtggccgctcagcgccaggatcgcctcacagtgggggtg
tacgagtcggccaagttgatgaatgtggacccagacagcgtggtcctctgcctcttggcc
attgacgaggaggaggaggatgacatcgccctgcaaatccacttcacgctcatccagtcc
ttctgctgtgacaacgacatcaacatcgtgcgggtgtcgggcatgcagcgcctggcgcag
ctcctgggagagccggccgagacccagggcaccaccgaggcccgagacctgcattgtctc
ctggtcacgaaccctcacacggacgcctggaagagccacggcttggtggaggtagccagc
tactgcgaagaaagccggggcaacaaccagtgggtcccctacatctcccttcaggaacgc
tga

DBGET integrated database retrieval system