KEGG   Pan troglodytes (chimpanzee): 460451
Entry
460451            CDS       T01005                                 

Gene name
IL17RB
Definition
(RefSeq) interleukin-17 receptor B isoform X1
  KO
K05165  interleukin 17 receptor B
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    460451 (IL17RB)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    460451 (IL17RB)
Cytokine receptors [BR:ptr04050]
 Interleukin receptor families
  IL17 receptor family
   460451 (IL17RB)
SSDB
Motif
Pfam: SEFIR IL17R_fnIII_D1 IL17R_fnIII_D2 DUF3262
Other DBs
NCBI-GeneID: 460451
NCBI-ProteinID: XP_001173276
Ensembl: ENSPTRG00000015028
VGNC: 1844
UniProt: A0A6D2WLA7 H2R3A1
LinkDB
Position
3
AA seq 505 aa
MSLVLLSLAALCRSAVPREPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVELVTTSVATG
DYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWT
FSYVGFPVELNTVYFIGAHNIPNANMNEDGPSMPVNFTSPGCLDHIMKYKKKCVKAGSLW
DPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTHSTVIGFSQVFEPHQKKQTRASVVI
PVTGDSEGAMVQLTPYFPTCGSDCIRHKGIVVLCPQTGVPFPLDNNKSKLGGWLPLLLLS
LLVATWVLVAGIYLMWRHERIKKTSFSTTTLLPPIKVLVVYPSEICFHHTICYFTEFLQN
HCRSEVILEKWQKKKIAEMGPVQWLATQKKAADKVVFLLSNDVNSVCDGTCGKSEGSPSE
NSQDLFPLAFNLFCSDLRSQIHLHKYVVVYFRETDTKDDYNALSVCPKYHLMKDATAFCA
ELLHVKQQVSAGKRSQACHDGCCSL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgtcgctcgtgctgctaagcctggccgcgctgtgcaggagcgccgtaccccgagagccg
accgttcaatgtggctctgaaactgggccatctccagagtggatgctacaacatgatcta
atccccggagacttgagggacctccgagtagaacttgttacaactagtgttgcaacaggg
gactattcaattttgatgaatgtaagctgggtactccgggcagatgccagcatccgcttg
ttgaaggccaccaagatttgtgtgacgggcaaaagcaacttccagtcctacagctgtgtg
aggtgcaattacacagaggccttccagactcagaccagaccctctggtggtaaatggaca
ttttcctacgtcggcttccctgtagagctgaacacagtctatttcattggggcccataat
attcctaatgcaaatatgaatgaagatggcccctccatgcctgtgaatttcacctcacca
ggctgcctagaccacataatgaaatataaaaaaaagtgtgtcaaggccggaagcctgtgg
gatccgaacatcactgcttgtaagaagaatgaggagacagtagaagtgaacttcacaacc
actcccctgggaaacagatacatggctcttatccaacacagcactcacagcactgtcatc
gggttttctcaggtgtttgagccacaccagaagaaacaaacgcgagcttcagtggtgatt
ccagtgactggggatagtgaaggtgctatggtgcagctgactccatattttcccacttgt
ggcagcgattgcatccgacataaaggaatagttgtgctctgcccacaaacaggcgtccct
ttccctctggataacaacaaaagcaagctgggaggctggctgcctctcctcctgctgtct
ctgctggtggccacatgggtgctggtggcagggatctatctaatgtggaggcacgaaagg
atcaagaagacttccttttctaccaccacactactgccccccattaaggttcttgtggtt
tacccatctgaaatatgtttccatcacacaatttgttacttcactgaatttcttcaaaac
cattgcagaagtgaggtcatccttgaaaagtggcagaaaaagaaaatagcagagatgggt
ccagtgcagtggcttgccactcaaaagaaggcagcagacaaagtcgtcttccttctttcc
aatgacgtcaacagtgtgtgcgatggtacctgtggcaagagcgagggcagtcccagtgag
aactctcaagacctcttcccccttgcctttaaccttttctgcagtgatctaagaagccag
attcatctgcacaaatacgtggtggtctactttagagagactgatacaaaagacgattat
aatgctctcagtgtctgccctaagtaccacctcatgaaggatgccactgctttctgtgca
gaacttctccatgtcaagcagcaggtgtcagcaggaaaaagatcacaagcctgccacgat
ggctgctgctccttgtag

DBGET integrated database retrieval system