KEGG   Pan troglodytes (chimpanzee): 460956
Entry
460956            CDS       T01005                                 

Gene name
TFRC
Definition
(RefSeq) transferrin receptor protein 1
  KO
K06503  transferrin receptor
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04066  HIF-1 signaling pathway
ptr04144  Endocytosis
ptr04145  Phagosome
ptr04216  Ferroptosis
ptr04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    460956 (TFRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    460956 (TFRC)
   04145 Phagosome
    460956 (TFRC)
  09143 Cell growth and death
   04216 Ferroptosis
    460956 (TFRC)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    460956 (TFRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptr01002]
    460956 (TFRC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    460956 (TFRC)
   04090 CD molecules [BR:ptr04090]
    460956 (TFRC)
Peptidases and inhibitors [BR:ptr01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   460956 (TFRC)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   460956 (TFRC)
  Exosomal proteins of colorectal cancer cells
   460956 (TFRC)
CD molecules [BR:ptr04090]
 Proteins
  460956 (TFRC)
SSDB
Motif
Pfam: TFR_dimer Peptidase_M28 PA DUF3855
Other DBs
NCBI-GeneID: 460956
NCBI-ProteinID: XP_003310238
Ensembl: ENSPTRG00000015773
VGNC: 2602
UniProt: A0A6D2XMZ2 H2R4A3
LinkDB
Position
3
AA seq 760 aa
MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPK
RCSGSICYGTIAVIVFFLIGFMIGYLGYCKGVEPKTQCERLAGTESPVREEPGEDFPAAR
RLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSK
VWRDQHFVKIQVKDSAQNSVIIVDKNGSLVYLVENPGGYVAYSKAATVTGKLVHANFGTK
KDFEDLHTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGH
AHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTVSRAAAEKLFGNMEGDCPSDWKTD
STCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG
VGTALLLKLAQMFSVMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFT
YINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNA
AFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIK
LTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDF
GNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRK
QNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgatggatcaagctagatcagcattctctaacttgtttggtggagaaccattgtcatat
acccggttcagcctggctcggcaagtagatggcgataacagtcatgtggagatgaaactt
gctgtagatgaagaagaaaatgctgacaataacacaaaggccaatgtcacaaaaccaaaa
aggtgtagtggaagtatctgctatgggactattgctgtgatcgtctttttcttgattgga
tttatgattggctacttgggctattgtaaaggggtagaaccaaaaactcagtgtgagaga
ctggcaggaaccgagtctccagtgagggaggagccaggagaggacttccctgcagcacgt
cgcttatattgggatgacctgaagagaaagttgtcggagaaactggacagcacagacttc
accggcaccatcaagctgctgaatgaaaattcatatgtccctcgtgaggctggatctcaa
aaagatgaaaatcttgcgttgtatgttgaaaatcaatttcgtgaatttaaactcagcaaa
gtctggcgtgatcaacattttgttaagattcaggtcaaagacagcgctcaaaactcggtg
atcatagttgataagaacggtagccttgtttacctggtggagaatcctgggggttatgtg
gcgtatagtaaggctgcaacagttactggtaaactggtccatgctaattttggtactaaa
aaagattttgaggatttacacactcctgtgaatggatctatagtgattgtcagagcaggg
aaaatcacctttgcagaaaaggttgcaaatgctgaaagcttaaatgcaattggtgtgttg
atatacatggaccagactaaatttcccattgttaacgcagaactttcattctttggacat
gctcatctggggacaggtgacccttacacacctggattcccttccttcaatcacactcag
tttccaccatctcggtcatcaggattgcctaatatacctgtccagacagtctccagagct
gctgcagaaaagctgtttgggaatatggaaggagactgtccctctgactggaaaacagac
tctacatgtaggatggtaacctcagaaagcaagaatgtgaagctcactgtgagcaatgtg
ctgaaagagataaaaattcttaacatctttggagttattaaaggctttgtagaaccagat
cactatgttgtagttggggcccagagagatgcatggggccctggagctgcaaaatccggt
gtaggcacagctctcctattgaaacttgcccagatgttctcagttatggtcttaaaagat
gggtttcagcccagcagaagcattatctttgccagttggagtgctggagactttggatcg
gttggtgccactgaatggctggagggatacctttcgtccctgcatttaaaggctttcact
tacattaatctggataaagcggttcttggtaccagcaacttcaaggtttctgccagccca
ctgttgtatacgcttattgagaaaacaatgcaaaatgtgaagcatccggttactgggcaa
tttctatatcaggacagcaactgggccagcaaagttgagaaactcactttagacaatgct
gctttccctttccttgcatattctggaatcccagcagtttctttctgtttttgcgaggac
acagattatccttatttgggtaccaccatggacacctataaggaactgattgagaggatt
cctgagttgaacaaagtggcacgagcagctgcagaggtcgctggtcagttcgtgattaaa
ctaacccatgatgttgaattgaacctggactatgagaggtacaacagccaactgctttca
tttgtgagggatctgaaccaatacagagcagacataaaggaaatgggcctgagtttacag
tggctgtattctgctcgtggagacttcttccgtgctacttccagactaacaacagatttc
gggaatgctgagaaaacagacagatttgtcatgaagaaactcaatgatcgtgtcatgaga
gtggagtatcacttcctctctccctacgtatctccaaaagagtctcctttccgacatgtc
ttctggggctccggctctcacacgctgccagctttactggagaacttgaaactgcgtaaa
caaaataacggtgcttttaatgaaacgctgttcagaaaccagttggctctagctacttgg
actattcagggagctgcaaatgccctctctggtgacgtttgggacattgacaatgagttt
taa

DBGET integrated database retrieval system