KEGG   Pan troglodytes (chimpanzee): 462616
Entry
462616            CDS       T01005                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01524  Platinum drug resistance
ptr04141  Protein processing in endoplasmic reticulum
ptr04210  Apoptosis
ptr04215  Apoptosis - multiple species
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05160  Hepatitis C
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05203  Viral carcinogenesis
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05216  Thyroid cancer
ptr05217  Basal cell carcinoma
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    462616 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    462616 (BAK1)
   04215 Apoptosis - multiple species
    462616 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    462616 (BAK1)
   05202 Transcriptional misregulation in cancer
    462616 (BAK1)
   05206 MicroRNAs in cancer
    462616 (BAK1)
   05203 Viral carcinogenesis
    462616 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    462616 (BAK1)
   05212 Pancreatic cancer
    462616 (BAK1)
   05225 Hepatocellular carcinoma
    462616 (BAK1)
   05226 Gastric cancer
    462616 (BAK1)
   05214 Glioma
    462616 (BAK1)
   05216 Thyroid cancer
    462616 (BAK1)
   05220 Chronic myeloid leukemia
    462616 (BAK1)
   05217 Basal cell carcinoma
    462616 (BAK1)
   05218 Melanoma
    462616 (BAK1)
   05213 Endometrial cancer
    462616 (BAK1)
   05224 Breast cancer
    462616 (BAK1)
   05222 Small cell lung cancer
    462616 (BAK1)
   05223 Non-small cell lung cancer
    462616 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    462616 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    462616 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    462616 (BAK1)
   05160 Hepatitis C
    462616 (BAK1)
   05164 Influenza A
    462616 (BAK1)
   05162 Measles
    462616 (BAK1)
   05168 Herpes simplex virus 1 infection
    462616 (BAK1)
   05163 Human cytomegalovirus infection
    462616 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    462616 (BAK1)
   05169 Epstein-Barr virus infection
    462616 (BAK1)
   05165 Human papillomavirus infection
    462616 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    462616 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ptr03029]
    462616 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptr02000]
    462616 (BAK1)
Mitochondrial biogenesis [BR:ptr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    462616 (BAK1)
Transporters [BR:ptr02000]
 Other transporters
  Pores ion channels [TC:1]
   462616 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 462616
NCBI-ProteinID: XP_518407
Ensembl: ENSPTRG00000018053
VGNC: 8158
UniProt: H2R7E3 A0A6D2WCB9
LinkDB
Position
6
AA seq 211 aa
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGAAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE
SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgccctgccc
tctgcttctgaggagcaggtagcccaggacacagaggaggttttccgcagctacgttttt
taccgccatcagcaggaacaggaggctgaaggggcggctgcccctgccgacccagagatg
gtcaccttacctctgcaacctagcagcaccatggggcaggtgggacggcagctcgccatc
atcggggacgacatcaaccgacgctatgactcagagttccagaccatgttgcagcacctg
cagcccacggcagagaatgcctatgagtacttcaccaagattgccaccagcctgtttgag
agtggcatcaactggggccgtgtggtggctcttctgggcttcggctaccgtctggcccta
cacgtctaccagcatggcctgactggcttcctgggccaggtgacccgcttcgtggtcgac
ttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagcc
ctgaacttgggcaatggtcccatcctgaacgtgctggtagttctgggtgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system