KEGG   Pan troglodytes (chimpanzee): 464586
Entry
464586            CDS       T01005                                 

Gene name
SYK
Definition
(RefSeq) tyrosine-protein kinase SYK isoform X1
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04064  NF-kappa B signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04380  Osteoclast differentiation
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04625  C-type lectin receptor signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr05152  Tuberculosis
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05171  Coronavirus disease - COVID-19
ptr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    464586 (SYK)
   04072 Phospholipase D signaling pathway
    464586 (SYK)
   04151 PI3K-Akt signaling pathway
    464586 (SYK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    464586 (SYK)
   04613  Neutrophil extracellular trap formation
    464586 (SYK)
   04625 C-type lectin receptor signaling pathway
    464586 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    464586 (SYK)
   04662 B cell receptor signaling pathway
    464586 (SYK)
   04664 Fc epsilon RI signaling pathway
    464586 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    464586 (SYK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    464586 (SYK)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    464586 (SYK)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    464586 (SYK)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    464586 (SYK)
   05168 Herpes simplex virus 1 infection
    464586 (SYK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    464586 (SYK)
   05169 Epstein-Barr virus infection
    464586 (SYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    464586 (SYK)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     464586 (SYK)
Protein kinases [BR:ptr01001]
 Non-receptor tyrosine kinases
  SYK family
   464586 (SYK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 Kdo
Other DBs
NCBI-GeneID: 464586
NCBI-ProteinID: XP_016816608
Ensembl: ENSPTRG00000021098
VGNC: 13975
UniProt: A0A6D2XLW6 A0A2J8KTF6
LinkDB
Position
9
AA seq 635 aa
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGKK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAAEKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggccagcagcggcatggctgacagcgccaaccacctgcccttctttttcggcaacatc
acccgggaggaggcagaagattacctggtccaggggggcatgagtgatgggctttatttg
ctgcgccagagccgcaactacctgggcggcttcgccctgtccgtggcccacgggaagaag
gcacaccactacaccatcgagcgggagctgaatggcacctacgccatcgctggtggcagg
acccatgccagccctgccgacctctgccactaccactcccaggagtctgatggcctggtc
tgcctcctcaagaagcccttcaaccggccccaaggggtgcagcccaagactgggcccttt
gaggatttgaaggaaaacctcatcagggaatatgtgaagcagacatggaacctgcagggt
caggctctggagcaggccatcatcagtcagaagcctcagctggagaagctgatcgctacc
acagcccatgaaaaaatgccttggttccatggaaaaatctctcgggaagaatctgagcaa
attgtcctgataggatcaaagacaaatggaaagttcctgatccgagccagagacaacaat
ggctcctacgccctgtgcctgctgcacgaagggaaggtgctgcactatcgcatcgacaaa
gacaagacagggaagctctccatccccgagggaaagaagttcgacacgctctggcagcta
gtcgagcattattcttataaagcagatggtttgttaagagttcttactgtcccatgtcaa
aaaatcggcacacagggaaatgttaattttggaggccgtccacaacttccaggttcccat
cctgcgacttggtcagcgggtggaataatctcaagaatcaaatcatactccttcccaaag
cctggccacagaaagtcctcccctgcccaagggaaccggcaagagagtactgtgtcattc
aatccgtatgagccagaacttgcaccctgggctgcagaaaaaggcccccagagggaagcc
ctacccatggacacagaggtgtacgagagcccctacgcggaccccgaggagatcaggccc
aaggaggtttacctggaccgaaagctgctgacgctggaagacaaagaactgggctctggt
aattttggaactgtgaaaaagggctactaccaaatgaaaaaagttgtgaaaaccgtggct
gtgaaaatactgaaaaacgaggccaatgaccccgctcttaaagatgagttattagcagaa
gcaaatgtcatgcagcagctggacaacccgtacatcgtgcgcatgattgggatatgcgag
gccgagtcctggatgctggttatggagatggcagaacttggtcccctcaataagtatttg
cagcagaacagacatgtcaaggataagaacatcatagaactggttcatcaggtttccatg
ggcatgaagtacttggaggagagcaattttgtgcacagagatctggctgcaagaaatgtg
ttgctagttacccaacattacgccaagatcagtgatttcggactttccaaagcactgcgt
gctgatgaaaactactacaaggcccagacccatggaaagtggcctgtcaagtggtacgct
ccagaatgcatcaactactacaagttctccagcaaaagcgatgtctggagctttggagtg
ttgatgtgggaagcattctcctatgggcagaagccatatcgagggatgaaaggaagtgaa
gtcaccgctatgttagagaaaggagagcggatggggtgccctgcagggtgtccaagagag
atgtacgatctcatgaatctgtgctggacatacgatgtggaaaacaggcccggattcgca
gcagtggaactgcggctgcgcaattactactatgacgtggtgaactaa

DBGET integrated database retrieval system