KEGG   Pan troglodytes (chimpanzee): 469019
Entry
469019            CDS       T01005                                 

Gene name
NLRP4
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    469019 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ptr04054]
    469019 (NLRP4)
Membrane trafficking [BR:ptr04131]
 Autophagy
  Other autophagy associated proteins
   Others
    469019 (NLRP4)
Pattern recognition receptors [BR:ptr04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   469019 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 VirE AAA_14 AAA_22 ResIII DAP3 AAA_25 RNA_helicase NTPase_1 AAA_30
Other DBs
NCBI-GeneID: 469019
NCBI-ProteinID: XP_524404
Ensembl: ENSPTRG00000011530
VGNC: 13237
UniProt: A0A2J8JLD6
LinkDB
Position
19
AA seq 994 aa
MAASFFSEFGLMWYLEELKKEEFRKFKEHLKQMTLHLELKQIPWTEVKKASREELANLLI
KHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGYTKTYQAHAKQKFSRLWSSKSVTEIH
LYFEEEVKQEECDHLDRLFAPKETGKQPRTVIIQGPQGIGKTTLLMKLMMAWSDNKIFRD
RFLYTFYFCCRELRELPPTSLADLISREWPDPAAPITEIVSQPERLLFVIDSFEELQGSL
NEPDSDLCGDLMEKQPVQVLLSSLLRKKMLPEASLLIAVKPVCPKELQDQVTISEIYQPR
GFNESDRLVYFCCFFKDPKRAMEAFNLVRESEQLFSICQIPLLCWILCTSLKQEMQKGKD
LALTCQSTTSVYSSFVFNLFTPEGAEGPTPQSQHQLKALCSLAAEGMWTDTFEFCEDDLR
RNGVVDADIPALLGTKILLKYGERESSYVFLHVCIQEFCAALFYLLKSHLDHPHPAVRCV
QELLVANFEKARRAHWIFLGCFLTGLLNKKEQEKLDAFFGFQLSQEIKQQFHQCLKSLGE
HGNPQGQVDSLAIFYCLFEMQDPAFVKQAVNLLQEANFHIIDNVDLVVSAYCLKYCSSLR
KLCFSVQNVFKKEDEHSSTSDYSLVCWHHICSVLTTSGHLRELQVQDSTLSESTFVTWCN
QLRHPSCRLQKLGINNVSFSGQSVLLFEVLFYQPDLKYLSFTLTKLSRDDIRSLCDALNY
PAGNVKELGLVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTV
LVYLMLAFCHLSEQCCQYISEMLLHNKSVRYLDLSANVLKDEGLRTLCEALKHPDCCLDS
LCLVKCFITAAGCEDLASALISNQNLKILQVGCNEIGDVGVQLLCRALTHPDCRLEILGL
EECGLTSTCCKDLASVLTCSKTLQQLNLTLNTLDRTGVVVLCEALRHPECALQVLGLRKT
DFDEETQALLTAEEERNPNLTITDDCDTITRVEM
NT seq 2985 nt   +upstreamnt  +downstreamnt
atggcagcctctttcttctctgagtttggtcttatgtggtatctggaggagctcaaaaag
gaggagttcaggaaatttaaagaacatctcaagcaaatgactttgcatcttgaactcaag
cagattccctggactgaggtcaaaaaagcatcccgggaagaacttgcaaacctcttgatc
aagcactatgaagaacaacaagcttggaacataaccttaagaatctttcaaaagatggat
agaaaggatctctgcatgaaggtcatgagggagagaacaggatacacaaagacctatcaa
gctcacgcaaagcagaaattcagccgcttatggtccagcaagtctgtcactgagattcac
ctatactttgaggaggaagtcaagcaagaagaatgtgaccatttggaccgcctttttgct
cccaaggaaactgggaaacagccacgtacagtgatcattcaaggaccacaaggaattgga
aaaacgacactcctgatgaagctgatgatggcctggtcggacaacaagatctttcgggat
aggttcctgtacacattctatttctgctgcagagaactgagggagttgccgccaaccagt
ttggctgacttgatttccagagagtggcctgaccccgctgctcctataacagagatcgtg
tctcaaccggagagactcttgttcgtcatcgacagcttcgaagagctgcagggcagcttg
aatgaacccgattcggatctgtgtggtgacttgatggagaaacagccggtgcaggtgctt
ctgagcagtttgctgaggaagaagatgctcccggaggcctccctgctcatcgccgtcaaa
cccgtgtgcccgaaggagctccaggatcaggtgacgatctcagaaatctaccagccccgg
ggattcaacgagagtgataggttagtgtatttctgctgtttcttcaaagacccgaaaaga
gccatggaagccttcaatcttgtaagagaaagtgaacagctgttttccatatgccaaatc
ccgctcctctgctggatcctgtgtaccagtctgaagcaagagatgcagaaaggaaaagac
ctggccctgacctgccagagcactacctctgtgtactcctctttcgtctttaacctgttc
acacccgagggtgccgagggcccgactccgcaaagccaacaccagctgaaggccctgtgc
tccctggctgcagagggcatgtggacagacacatttgagttttgtgaagacgacctccgg
agaaacggggttgttgacgctgacatccctgcgctgctgggcaccaagatacttctgaag
tacggggagcgtgagagctcctacgtgttcctccacgtgtgtatccaggagttctgtgcc
gccttgttctatttgctcaagagccaccttgatcatcctcacccagctgtgagatgtgta
caggaattgctagttgccaattttgaaaaagcaaggagagcacattggatttttttgggg
tgttttctaactggccttttaaataaaaaggaacaagaaaaactggatgcgttttttggc
ttccaactgtcccaagagataaagcagcaatttcaccagtgcctgaagagcttaggggag
catggcaatcctcagggacaggtggattccttggcgatattttactgtctctttgaaatg
caggatcctgcctttgtgaagcaggcagtgaacctcctccaagaagctaactttcatatt
attgacaacgtggacttggtggtttctgcctactgcttaaaatactgctccagcttgagg
aaactctgtttttccgttcaaaatgtctttaagaaagaggatgaacacagctctacgtcg
gattacagcctcgtctgttggcatcacatctgctctgtgctcaccaccagcgggcacctc
agagagctccaggtgcaggacagcaccctcagcgagtcgacctttgtgacctggtgtaac
cagctgaggcatcccagctgtcgccttcagaagcttggaataaataacgtttccttttct
ggccagagtgttctgctctttgaggtgctcttttatcagccagacttgaaatacctgagc
ttcaccctcacgaaactctctcgtgatgacatcaggtccctctgtgatgccttgaactac
ccagcaggcaacgtcaaagagctagggctggtaaattgtcacctctcacccattgattgt
gaagtccttgctggccttctaaccaacaacaagaagctgacgtatctgaatgtatcctgc
aaccagttagacacaggcgtgccccttctgtgtgaagccctgtgcagcccagacacggtc
ctggtatacctgatgttggctttctgccacctcagcgagcagtgctgccaatacatctct
gaaatgcttctgcataacaagagcgtgcgctatctagacctcagtgccaatgtcctgaag
gacgaaggactgagaactctctgcgaggccttgaaacatccggactgctgcctggattca
ctgtgtttggtaaaatgttttatcactgctgccggctgtgaagacctcgcctctgctctc
atcagcaatcaaaacctgaagattctgcaagttgggtgcaatgaaatcggagacgtgggc
gtgcagctgttgtgtcgtgctctgacgcatccggattgccgcttagagattcttgggttg
gaagaatgtgggttaacgagcacctgctgtaaggatctcgcgtctgttctcacctgcagt
aagaccctgcagcagctcaacctgaccttgaacaccttggaccgcacaggggtggttgtg
ctctgtgaggccctgagacacccagagtgtgccctgcaggtgctcgggctgagaaaaact
gattttgatgaggaaacccaggcacttctgacggctgaggaagagagaaatcctaacctg
accatcacagacgactgtgacacaatcacaagggtagaaatgtga

DBGET integrated database retrieval system