Pan troglodytes (chimpanzee): 740729 Help Entry 740729            CDS       T01005                                  Symbol CXCL6 Name (RefSeq) C-X-C motif chemokine 6   KO K05506   C-X-C motif chemokine 5/6 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04062   Chemokine signaling pathway ptr04657   IL-17 signaling pathway ptr04668   TNF signaling pathway ptr05133   Pertussis ptr05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     740729 (CXCL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     740729 (CXCL6)    04061 Viral protein interaction with cytokine and cytokine receptor     740729 (CXCL6)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     740729 (CXCL6)    04062 Chemokine signaling pathway     740729 (CXCL6)  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     740729 (CXCL6)   09163 Immune disease    05323 Rheumatoid arthritis     740729 (CXCL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     740729 (CXCL6) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Chemokines    740729 (CXCL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  740729 NCBI-ProteinID:  XP_001156255 Ensembl:  ENSPTRG00000016155 VGNC:  8665 UniProt:  H2QPN3 A0A6D2WGT6 LinkDB All DBs Position 4:complement(55364479..55366753) Genome browser AA seq 114 aa AA seqDB search MSLRSSCAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLLVTLRVNP KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKIIQKILDSGNKKN NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgagcctccggtccagctgcgcggcccgtgtcccgggtccttcgggctccttgtgcgcg ctgctcgcgctgctgctcctgctgacgccgccggggcccctcgccagcgctggtcctgtc tctgctgtgctgacagagctgcgttgcacttgtttactcgttacgctgagagtaaacccc aaaacgattggtaaactgcaggtgttccccgcaggcccgcagtgctccaaggtggaagtg gtagcctccctgaagaacgggaagcaagtttgtctggacccggaagccccttttctaaag aaaatcatccagaaaattttggacagtggaaacaagaaaaactga

DBGET integrated database retrieval system