KEGG   Candidatus Pelagibacter ubique: SAR11_0457
Entry
SAR11_0457        CDS       T00257                                 

Gene name
fmt
Definition
(GenBank) Methionyl-tRNA formyltransferase
  KO
K00604  methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00670  One carbon pool by folate
pub00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAR11_0457 (fmt)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAR11_0457 (fmt)
Enzymes [BR:pub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     SAR11_0457 (fmt)
SSDB
Motif
Pfam: Formyl_trans_N Formyl_trans_C
Other DBs
NCBI-ProteinID: AAZ21279
UniProt: Q4FNG0
LinkDB
Position
452267..453199
AA seq 310 aa
MTKKIVFMGTPFFAVPILKSLYEKNYIIPAVYTQPPKKSQRGQKINKSPIQIVAEDYNID
CRTPDTLKTNKEEYEYLKQLDLDLVIVVAYGQIIPKEYLNLAKKGFINIHASLLPKWRGA
APIQRSIMNLEKETGISIMKIGEKLDTGPVGNIYRIKIKDSDNAETISTKLSILASEKII
ENVENIFEDKLTFKEQDDTSATYASKIEKSEGEIKWNDNAESIIGKINGLYPSPGAFFIF
KDERYKILKAELGNKSGEIGEVMSNDLEISCGNQKSIKIIEIQRQGKKPQNINEFVLGSQ
IIKGSRITNV
NT seq 933 nt   +upstreamnt  +downstreamnt
atgacaaagaaaattgtcttcatgggtacaccattttttgctgtaccaattttaaaatct
ttatatgaaaaaaattatataatacctgctgtatatacacagccaccaaaaaaatctcaa
agaggtcaaaaaataaataagtcgccaatacaaattgtagcagaagattataatatagat
tgtagaacaccagacacattaaaaacaaataaagaagaatatgaatatttaaaacaacta
gatttagatttagtaattgttgtggcctatggtcaaataatacccaaagaatatttaaat
cttgccaaaaaaggttttataaatattcacgcctcccttttgccaaagtggagaggtgct
gcacccattcaaaggtctattatgaatttagagaaagaaacaggaattagtattatgaaa
ataggagaaaaacttgatactggtccagttggcaatatttatagaataaaaattaaagat
agtgataatgcagaaacaatatcaactaaactttcaattttagcttcagaaaaaatcata
gaaaatgtagaaaatatatttgaagataaattaacatttaaagaacaagatgatacaagc
gcaacctatgcttctaaaattgaaaaatcagagggtgaaattaagtggaatgataatgca
gaaagtattattggaaaaataaacggattatacccaagccctggggccttttttattttt
aaagatgaaagatacaaaattttaaaagcagaattaggaaataaaagtggtgagataggc
gaagtaatgtccaatgatttagaaattagctgcggtaaccaaaaatctatcaaaattatt
gaaattcaaagacaaggaaaaaagcctcaaaatattaatgaatttgttcttggttctcaa
attataaaaggctcaagaataacaaatgtttag

DBGET integrated database retrieval system